Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R1W7

Protein Details
Accession A0A372R1W7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-145EREENIKKAKKKEAKKKEVRTKLKKENREQRNEKKEPTYBasic
NLS Segment(s)
PositionSequence
112-141IKKAKKKEAKKKEVRTKLKKENREQRNEKK
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MARYIPYIPIREAQFFLFSHVPTGIRNLKLQARNKLRIGFEACNPNEPSDKTNKLTSKSSLIKPILKSTTVKSTSKPTIKQTSRLASRPRRRFELFFFWKNWFFRNEREENIKKAKKKEAKKKEVRTKLKKENREQRNEKKEPTYMEPKCQSAEVAEEEEMKFAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.29
4 0.26
5 0.22
6 0.21
7 0.21
8 0.2
9 0.17
10 0.24
11 0.24
12 0.24
13 0.25
14 0.28
15 0.34
16 0.42
17 0.48
18 0.52
19 0.55
20 0.59
21 0.62
22 0.63
23 0.56
24 0.54
25 0.53
26 0.45
27 0.41
28 0.44
29 0.41
30 0.41
31 0.41
32 0.37
33 0.34
34 0.32
35 0.31
36 0.29
37 0.33
38 0.3
39 0.37
40 0.38
41 0.39
42 0.41
43 0.4
44 0.41
45 0.42
46 0.41
47 0.42
48 0.42
49 0.43
50 0.41
51 0.44
52 0.38
53 0.34
54 0.33
55 0.27
56 0.33
57 0.33
58 0.32
59 0.28
60 0.32
61 0.38
62 0.42
63 0.43
64 0.4
65 0.46
66 0.47
67 0.51
68 0.49
69 0.49
70 0.48
71 0.5
72 0.53
73 0.53
74 0.61
75 0.64
76 0.63
77 0.62
78 0.61
79 0.59
80 0.56
81 0.57
82 0.54
83 0.49
84 0.47
85 0.44
86 0.45
87 0.43
88 0.39
89 0.32
90 0.28
91 0.3
92 0.35
93 0.35
94 0.34
95 0.43
96 0.44
97 0.46
98 0.54
99 0.54
100 0.53
101 0.55
102 0.62
103 0.62
104 0.69
105 0.74
106 0.75
107 0.8
108 0.85
109 0.9
110 0.91
111 0.93
112 0.93
113 0.93
114 0.92
115 0.92
116 0.91
117 0.9
118 0.9
119 0.89
120 0.88
121 0.89
122 0.88
123 0.88
124 0.89
125 0.86
126 0.81
127 0.77
128 0.71
129 0.66
130 0.64
131 0.64
132 0.57
133 0.59
134 0.58
135 0.54
136 0.51
137 0.46
138 0.39
139 0.3
140 0.3
141 0.24
142 0.23
143 0.21
144 0.22
145 0.21
146 0.22