Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QVV2

Protein Details
Accession A0A372QVV2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-34EAAKSTGGGKNKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
6-28AAKSTGGGKNKKKKWSKGKVKDK
Subcellular Location(s) nucl 16, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKKEAAKSTGGGKNKKKKWSKGKVKDKANNAVVLDKATYDKLFKEVPTYKLITPSVLVDRLRVNGSLARVAIRELEEKGLIRKISTHGSQLIYTRATAVVDKPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.76
4 0.77
5 0.8
6 0.84
7 0.86
8 0.88
9 0.88
10 0.92
11 0.91
12 0.93
13 0.9
14 0.86
15 0.84
16 0.75
17 0.67
18 0.57
19 0.49
20 0.38
21 0.32
22 0.24
23 0.15
24 0.13
25 0.11
26 0.11
27 0.09
28 0.09
29 0.11
30 0.12
31 0.12
32 0.18
33 0.21
34 0.23
35 0.26
36 0.28
37 0.25
38 0.28
39 0.28
40 0.21
41 0.18
42 0.17
43 0.15
44 0.15
45 0.15
46 0.12
47 0.13
48 0.14
49 0.15
50 0.13
51 0.13
52 0.12
53 0.13
54 0.13
55 0.12
56 0.12
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.13
65 0.14
66 0.16
67 0.19
68 0.17
69 0.16
70 0.17
71 0.19
72 0.24
73 0.25
74 0.26
75 0.25
76 0.28
77 0.29
78 0.29
79 0.29
80 0.24
81 0.22
82 0.2
83 0.17
84 0.16
85 0.15
86 0.16