Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RU09

Protein Details
Accession A0A372RU09    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MGKVGRSRTHKGNRDKYRKYRTRNYAKDLDQHydrophilic
78-102ALNEHQRGKNHKKRVKLLKEVPYTQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGKVGRSRTHKGNRDKYRKYRTRNYAKDLDQVHEDIKKVTENGGDETILKIQEWNEDLPGLGQYYCIPCARYFINSEALNEHQRGKNHKKRVKLLKEVPYTQAEAEAAVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.9
4 0.91
5 0.91
6 0.89
7 0.89
8 0.88
9 0.89
10 0.87
11 0.84
12 0.81
13 0.75
14 0.72
15 0.64
16 0.55
17 0.46
18 0.39
19 0.33
20 0.26
21 0.24
22 0.18
23 0.17
24 0.15
25 0.13
26 0.13
27 0.14
28 0.13
29 0.15
30 0.15
31 0.14
32 0.13
33 0.13
34 0.13
35 0.11
36 0.09
37 0.08
38 0.07
39 0.09
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.05
49 0.05
50 0.06
51 0.07
52 0.09
53 0.09
54 0.1
55 0.09
56 0.12
57 0.13
58 0.14
59 0.16
60 0.16
61 0.23
62 0.22
63 0.23
64 0.23
65 0.25
66 0.26
67 0.25
68 0.27
69 0.24
70 0.28
71 0.36
72 0.45
73 0.51
74 0.59
75 0.63
76 0.68
77 0.74
78 0.81
79 0.82
80 0.82
81 0.82
82 0.81
83 0.84
84 0.78
85 0.72
86 0.64
87 0.56
88 0.46
89 0.39
90 0.28