Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QXM7

Protein Details
Accession A0A372QXM7   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28GNNLNFPTKQTRKKPYIPRPPNSFILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences PTGNNLNFPTKQTRKKPYIPRPPNSFILYRQHHHPLILNQHPGINNSEISRIIADHWRNLPNPEKEEWKRKADEAKQRHMKAWPDYKYQPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.76
3 0.83
4 0.84
5 0.86
6 0.86
7 0.86
8 0.84
9 0.81
10 0.77
11 0.69
12 0.6
13 0.53
14 0.52
15 0.48
16 0.42
17 0.41
18 0.42
19 0.39
20 0.37
21 0.36
22 0.32
23 0.35
24 0.37
25 0.34
26 0.28
27 0.3
28 0.3
29 0.27
30 0.25
31 0.18
32 0.14
33 0.13
34 0.14
35 0.12
36 0.11
37 0.1
38 0.08
39 0.08
40 0.14
41 0.14
42 0.17
43 0.2
44 0.23
45 0.23
46 0.27
47 0.33
48 0.32
49 0.35
50 0.34
51 0.4
52 0.43
53 0.52
54 0.54
55 0.53
56 0.51
57 0.52
58 0.59
59 0.59
60 0.63
61 0.62
62 0.67
63 0.71
64 0.7
65 0.7
66 0.66
67 0.64
68 0.63
69 0.65
70 0.6
71 0.58
72 0.64