Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R3V7

Protein Details
Accession A0A372R3V7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-57IDRCLRQKAKKRRLNINLKKVKHydrophilic
NLS Segment(s)
PositionSequence
44-48AKKRR
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MTFWDWVYSESKITFIDIIKGIISCELSAYTWGFWIDRCLRQKAKKRRLNINLKKVKENYNVDKYIDPNRKINTNNLFKGLDSLRLNEGCSLNDVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.17
4 0.15
5 0.15
6 0.14
7 0.14
8 0.13
9 0.12
10 0.12
11 0.08
12 0.07
13 0.07
14 0.07
15 0.08
16 0.09
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.13
23 0.15
24 0.21
25 0.25
26 0.3
27 0.37
28 0.45
29 0.56
30 0.61
31 0.68
32 0.68
33 0.71
34 0.76
35 0.79
36 0.82
37 0.81
38 0.81
39 0.78
40 0.75
41 0.74
42 0.66
43 0.63
44 0.6
45 0.58
46 0.54
47 0.53
48 0.53
49 0.49
50 0.47
51 0.43
52 0.44
53 0.46
54 0.4
55 0.39
56 0.4
57 0.44
58 0.44
59 0.5
60 0.5
61 0.5
62 0.5
63 0.48
64 0.46
65 0.4
66 0.43
67 0.36
68 0.34
69 0.27
70 0.27
71 0.28
72 0.28
73 0.29
74 0.29
75 0.29
76 0.22