Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QD89

Protein Details
Accession A0A372QD89    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-56FEDPSRRHKRRKFTKEDAYLBasic
NLS Segment(s)
PositionSequence
43-48RHKRRK
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR022159  STIP/TFIP11_N  
Pfam View protein in Pfam  
PF12457  TIP_N  
Amino Acid Sequences MPRHKKDIDDGLDTSSESDKELFEISDTLLLEEKELFEDPSRRHKRRKFTKEDAYLGIWADSEDDRPNRKKRDVRFVASTSKSVTNENDTAEKDMYVII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.22
3 0.17
4 0.13
5 0.12
6 0.1
7 0.1
8 0.11
9 0.1
10 0.09
11 0.09
12 0.09
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.09
24 0.09
25 0.14
26 0.16
27 0.27
28 0.36
29 0.4
30 0.49
31 0.55
32 0.64
33 0.71
34 0.79
35 0.77
36 0.77
37 0.82
38 0.79
39 0.75
40 0.67
41 0.57
42 0.47
43 0.37
44 0.28
45 0.18
46 0.11
47 0.09
48 0.07
49 0.07
50 0.1
51 0.13
52 0.19
53 0.27
54 0.35
55 0.4
56 0.49
57 0.55
58 0.59
59 0.67
60 0.69
61 0.69
62 0.68
63 0.66
64 0.66
65 0.61
66 0.55
67 0.47
68 0.43
69 0.38
70 0.33
71 0.32
72 0.3
73 0.29
74 0.31
75 0.31
76 0.29
77 0.31
78 0.29
79 0.26