Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QL23

Protein Details
Accession A0A372QL23    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-55SSYASFAIRRRRNQRRLRHITINISSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MDTNEPTNRERAPTCDNLNPSCDTTSNNPSSYASFAIRRRRNQRRLRHITINISSFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.44
4 0.41
5 0.42
6 0.39
7 0.34
8 0.29
9 0.24
10 0.21
11 0.22
12 0.27
13 0.27
14 0.25
15 0.24
16 0.23
17 0.24
18 0.23
19 0.2
20 0.15
21 0.18
22 0.23
23 0.33
24 0.39
25 0.47
26 0.56
27 0.65
28 0.74
29 0.79
30 0.84
31 0.85
32 0.88
33 0.87
34 0.87
35 0.82
36 0.81
37 0.78