Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R7R2

Protein Details
Accession A0A372R7R2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
94-119NRDMKNFWYARKRRQDRQKENVLDPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 12.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPPIIFNKEELKGSNRKSCPFAKLSRKIPYSPNQILQHWRDKLDPRLCKLPFNYNEKNFIINWVNKFLAENDKNISWKKLQSEMVKEFAILRSNRDMKNFWYARKRRQDRQKENVLDPQLLEDSDFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.49
4 0.52
5 0.54
6 0.54
7 0.53
8 0.56
9 0.57
10 0.61
11 0.65
12 0.69
13 0.68
14 0.64
15 0.65
16 0.64
17 0.62
18 0.58
19 0.59
20 0.53
21 0.52
22 0.56
23 0.54
24 0.54
25 0.47
26 0.44
27 0.4
28 0.41
29 0.47
30 0.49
31 0.49
32 0.45
33 0.52
34 0.51
35 0.5
36 0.48
37 0.49
38 0.46
39 0.49
40 0.52
41 0.45
42 0.5
43 0.46
44 0.45
45 0.35
46 0.33
47 0.29
48 0.25
49 0.24
50 0.21
51 0.21
52 0.19
53 0.2
54 0.17
55 0.22
56 0.2
57 0.2
58 0.19
59 0.2
60 0.23
61 0.23
62 0.25
63 0.18
64 0.2
65 0.21
66 0.25
67 0.3
68 0.33
69 0.39
70 0.4
71 0.4
72 0.37
73 0.35
74 0.3
75 0.26
76 0.27
77 0.2
78 0.2
79 0.25
80 0.31
81 0.33
82 0.35
83 0.35
84 0.32
85 0.42
86 0.42
87 0.41
88 0.47
89 0.52
90 0.59
91 0.68
92 0.73
93 0.73
94 0.8
95 0.85
96 0.85
97 0.88
98 0.88
99 0.84
100 0.81
101 0.79
102 0.72
103 0.62
104 0.51
105 0.45
106 0.35
107 0.28