Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QKM5

Protein Details
Accession A0A372QKM5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-126TIDMNMQEKQKKKKKLPKRPLQDHydrophilic
NLS Segment(s)
PositionSequence
112-123KQKKKKKLPKRP
Subcellular Location(s) nucl 17.5, mito_nucl 14, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSTSILKTHYRRSATVLTSEQIKEIRHLKNKVPVYMIVKEYYINKNHVHDIWNGCERYQQNGNHFFEELRKVQSISSVPPLENNLQEKENNHPISGSLELFHETIDMNMQEKQKKKKKLPKRPLQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.43
4 0.36
5 0.37
6 0.36
7 0.32
8 0.27
9 0.25
10 0.24
11 0.29
12 0.36
13 0.39
14 0.43
15 0.46
16 0.53
17 0.56
18 0.54
19 0.49
20 0.45
21 0.42
22 0.42
23 0.39
24 0.3
25 0.26
26 0.25
27 0.26
28 0.27
29 0.25
30 0.24
31 0.24
32 0.25
33 0.27
34 0.27
35 0.26
36 0.25
37 0.25
38 0.26
39 0.29
40 0.27
41 0.24
42 0.28
43 0.26
44 0.26
45 0.3
46 0.28
47 0.29
48 0.36
49 0.38
50 0.34
51 0.34
52 0.29
53 0.25
54 0.27
55 0.22
56 0.17
57 0.16
58 0.15
59 0.15
60 0.18
61 0.17
62 0.15
63 0.2
64 0.18
65 0.18
66 0.19
67 0.22
68 0.2
69 0.22
70 0.23
71 0.19
72 0.2
73 0.22
74 0.22
75 0.26
76 0.33
77 0.31
78 0.28
79 0.26
80 0.25
81 0.26
82 0.27
83 0.2
84 0.12
85 0.12
86 0.13
87 0.13
88 0.12
89 0.1
90 0.08
91 0.08
92 0.1
93 0.1
94 0.1
95 0.14
96 0.19
97 0.26
98 0.33
99 0.44
100 0.51
101 0.61
102 0.7
103 0.77
104 0.83
105 0.88
106 0.92