Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RER3

Protein Details
Accession A0A372RER3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
11-44GKVKSQTPKVEKQEKKKKKAGRAKKRILYNRRFVBasic
NLS Segment(s)
PositionSequence
11-37GKVKSQTPKVEKQEKKKKKAGRAKKRI
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVEKQEKKKKKAGRAKKRILYNRRFVNVTNMIGGKRRVNVNYIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.5
4 0.54
5 0.63
6 0.66
7 0.71
8 0.72
9 0.75
10 0.79
11 0.8
12 0.82
13 0.81
14 0.8
15 0.8
16 0.83
17 0.83
18 0.83
19 0.84
20 0.85
21 0.83
22 0.85
23 0.85
24 0.84
25 0.81
26 0.78
27 0.75
28 0.69
29 0.64
30 0.55
31 0.53
32 0.48
33 0.41
34 0.36
35 0.29
36 0.27
37 0.29
38 0.32
39 0.26
40 0.26
41 0.3
42 0.29