Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RDZ7

Protein Details
Accession A0A372RDZ7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-33SSNSLRSRIKRVRRSEMPPQPQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9, mito 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018289  MULE_transposase_dom  
Pfam View protein in Pfam  
PF10551  MULE  
Amino Acid Sequences MSQEYHPYMPSSNSLRSRIKRVRRSEMPPQPQTLEEINIPDFLQFTFNGVRFLVRDFVVGEYRILLFTTQANIQHLSQAPFWMMDGTFKTVPVIFMQLYTIHAPVGGDNSRVLPLVYSLVTSKSVEIYRCLFEELLDFAIENSIDLQPSVILTDFEQASIIASRLVFLTFAIKDVSFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.49
3 0.52
4 0.61
5 0.65
6 0.7
7 0.72
8 0.75
9 0.79
10 0.78
11 0.81
12 0.82
13 0.82
14 0.82
15 0.76
16 0.71
17 0.63
18 0.55
19 0.51
20 0.42
21 0.34
22 0.25
23 0.23
24 0.2
25 0.18
26 0.18
27 0.14
28 0.12
29 0.1
30 0.11
31 0.08
32 0.1
33 0.13
34 0.13
35 0.14
36 0.14
37 0.14
38 0.13
39 0.15
40 0.14
41 0.11
42 0.11
43 0.1
44 0.12
45 0.13
46 0.13
47 0.12
48 0.1
49 0.1
50 0.1
51 0.09
52 0.07
53 0.06
54 0.06
55 0.08
56 0.09
57 0.1
58 0.11
59 0.12
60 0.12
61 0.15
62 0.16
63 0.16
64 0.15
65 0.14
66 0.13
67 0.11
68 0.11
69 0.09
70 0.07
71 0.06
72 0.07
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.1
79 0.09
80 0.1
81 0.07
82 0.07
83 0.07
84 0.07
85 0.09
86 0.09
87 0.09
88 0.07
89 0.07
90 0.07
91 0.06
92 0.09
93 0.08
94 0.08
95 0.08
96 0.09
97 0.1
98 0.1
99 0.1
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.1
108 0.1
109 0.1
110 0.11
111 0.14
112 0.14
113 0.16
114 0.17
115 0.18
116 0.18
117 0.19
118 0.16
119 0.14
120 0.15
121 0.14
122 0.12
123 0.1
124 0.09
125 0.08
126 0.09
127 0.08
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.06
135 0.07
136 0.08
137 0.06
138 0.06
139 0.07
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.11
146 0.11
147 0.11
148 0.08
149 0.08
150 0.09
151 0.09
152 0.09
153 0.08
154 0.07
155 0.12
156 0.11
157 0.12
158 0.14