Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q8W2

Protein Details
Accession A0A372Q8W2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-88TGSICKYKSNCNTNKCRCKKSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, mito 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTSAMIAKSKHKLEYEIRNGILNNLYCAGELDPFGVKEYPELDHIPTDNISVREAARNQSSSTGILTGSICKYKSNCNTNKCRCKKSGTRCESKCHSGKSCNNKTQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.54
4 0.51
5 0.49
6 0.47
7 0.43
8 0.4
9 0.3
10 0.23
11 0.18
12 0.17
13 0.15
14 0.16
15 0.14
16 0.1
17 0.1
18 0.09
19 0.09
20 0.09
21 0.1
22 0.1
23 0.09
24 0.09
25 0.1
26 0.1
27 0.12
28 0.13
29 0.12
30 0.12
31 0.13
32 0.13
33 0.12
34 0.12
35 0.11
36 0.11
37 0.1
38 0.1
39 0.1
40 0.12
41 0.13
42 0.14
43 0.14
44 0.15
45 0.14
46 0.15
47 0.16
48 0.14
49 0.13
50 0.11
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.12
57 0.11
58 0.13
59 0.15
60 0.23
61 0.31
62 0.39
63 0.46
64 0.52
65 0.63
66 0.72
67 0.82
68 0.81
69 0.8
70 0.75
71 0.76
72 0.78
73 0.78
74 0.78
75 0.77
76 0.79
77 0.76
78 0.8
79 0.78
80 0.76
81 0.72
82 0.69
83 0.66
84 0.66
85 0.71
86 0.74
87 0.77