Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QQB5

Protein Details
Accession A0A372QQB5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LRPRQYARISKRQKKVQRAYGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRLTYRRRLSYNTKSNRVRVIKTPGGKLTWLYEKKPAKGPHCGDCGSRLSGIPALRPRQYARISKRQKKVQRAYGGSRCAGCVRDRIVRAFLIEEQKIVKKVIKASATKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.74
4 0.73
5 0.76
6 0.71
7 0.65
8 0.61
9 0.61
10 0.59
11 0.57
12 0.58
13 0.51
14 0.47
15 0.43
16 0.37
17 0.32
18 0.34
19 0.33
20 0.3
21 0.36
22 0.39
23 0.41
24 0.48
25 0.51
26 0.45
27 0.52
28 0.53
29 0.51
30 0.5
31 0.48
32 0.41
33 0.37
34 0.36
35 0.27
36 0.24
37 0.18
38 0.15
39 0.16
40 0.16
41 0.16
42 0.18
43 0.19
44 0.2
45 0.22
46 0.22
47 0.26
48 0.32
49 0.37
50 0.39
51 0.47
52 0.57
53 0.64
54 0.71
55 0.74
56 0.78
57 0.8
58 0.82
59 0.81
60 0.8
61 0.76
62 0.76
63 0.73
64 0.68
65 0.59
66 0.5
67 0.42
68 0.35
69 0.31
70 0.24
71 0.21
72 0.22
73 0.27
74 0.29
75 0.3
76 0.31
77 0.29
78 0.29
79 0.27
80 0.27
81 0.27
82 0.25
83 0.24
84 0.25
85 0.28
86 0.29
87 0.28
88 0.28
89 0.25
90 0.31
91 0.38
92 0.42