Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RK03

Protein Details
Accession A0A372RK03    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-37QTTQSIVKSKYKKSKCPECNKRRKPLDESHQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences LNITLIQTTQSIVKSKYKKSKCPECNKRRKPLDESHQICHVCYKIKRAYKYGLSGNKIVDDFIRHTQNNLVRSQGKMEFVPYEQFINIEFIAEGGFSKIYKATWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.44
3 0.54
4 0.6
5 0.66
6 0.73
7 0.8
8 0.82
9 0.86
10 0.88
11 0.89
12 0.92
13 0.92
14 0.93
15 0.91
16 0.87
17 0.83
18 0.82
19 0.8
20 0.79
21 0.74
22 0.66
23 0.64
24 0.57
25 0.49
26 0.42
27 0.33
28 0.29
29 0.26
30 0.3
31 0.31
32 0.37
33 0.4
34 0.41
35 0.44
36 0.42
37 0.44
38 0.44
39 0.42
40 0.39
41 0.37
42 0.34
43 0.3
44 0.26
45 0.23
46 0.16
47 0.13
48 0.13
49 0.16
50 0.21
51 0.19
52 0.2
53 0.25
54 0.29
55 0.3
56 0.28
57 0.28
58 0.24
59 0.25
60 0.28
61 0.25
62 0.23
63 0.2
64 0.22
65 0.19
66 0.19
67 0.21
68 0.18
69 0.17
70 0.15
71 0.15
72 0.14
73 0.15
74 0.14
75 0.11
76 0.1
77 0.09
78 0.09
79 0.08
80 0.08
81 0.06
82 0.07
83 0.06
84 0.07
85 0.09