Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R4S4

Protein Details
Accession A0A372R4S4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
51-71YKEIRKKNADKAKENRKKVEEBasic
NLS Segment(s)
PositionSequence
55-68RKKNADKAKENRKK
Subcellular Location(s) nucl 11, cyto_nucl 10, mito 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPNLAYHKHPKCLDVILRLEECHKSGFFNKYFGGCNGIKKELNECLTLEYKEIRKKNADKAKENRKKVEELWKEFNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.41
4 0.37
5 0.37
6 0.36
7 0.36
8 0.3
9 0.26
10 0.21
11 0.18
12 0.15
13 0.19
14 0.25
15 0.24
16 0.25
17 0.25
18 0.25
19 0.26
20 0.24
21 0.25
22 0.19
23 0.22
24 0.22
25 0.24
26 0.23
27 0.22
28 0.24
29 0.24
30 0.24
31 0.21
32 0.19
33 0.19
34 0.21
35 0.2
36 0.19
37 0.18
38 0.21
39 0.28
40 0.3
41 0.31
42 0.37
43 0.42
44 0.52
45 0.58
46 0.61
47 0.63
48 0.71
49 0.78
50 0.8
51 0.82
52 0.81
53 0.76
54 0.73
55 0.69
56 0.7
57 0.69
58 0.67