Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RMA8

Protein Details
Accession A0A372RMA8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-40CGKPYVQKIKLNNNKRTRRKPSKLICTDCEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.499, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGSRTCGKPYVQKIKLNNNKRTRRKPSKLICTDCEESNDYIKLLSSKVSRIEEIVDNFMNLPKNKTENKLSIFNAKFSLNNVPCELEYDLSNFTLENLQKLVIFTTPNCKPNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.65
4 0.66
5 0.67
6 0.72
7 0.77
8 0.79
9 0.79
10 0.78
11 0.82
12 0.86
13 0.89
14 0.89
15 0.9
16 0.89
17 0.89
18 0.89
19 0.9
20 0.89
21 0.84
22 0.77
23 0.73
24 0.66
25 0.57
26 0.5
27 0.41
28 0.32
29 0.28
30 0.25
31 0.17
32 0.14
33 0.14
34 0.11
35 0.09
36 0.11
37 0.1
38 0.11
39 0.15
40 0.17
41 0.16
42 0.16
43 0.18
44 0.17
45 0.17
46 0.18
47 0.14
48 0.13
49 0.12
50 0.14
51 0.15
52 0.13
53 0.14
54 0.13
55 0.18
56 0.21
57 0.25
58 0.29
59 0.31
60 0.34
61 0.38
62 0.38
63 0.42
64 0.41
65 0.38
66 0.35
67 0.3
68 0.26
69 0.23
70 0.31
71 0.24
72 0.26
73 0.25
74 0.25
75 0.24
76 0.27
77 0.26
78 0.17
79 0.15
80 0.15
81 0.15
82 0.14
83 0.14
84 0.1
85 0.1
86 0.15
87 0.15
88 0.15
89 0.14
90 0.15
91 0.15
92 0.16
93 0.16
94 0.12
95 0.14
96 0.14
97 0.22
98 0.28