Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RA02

Protein Details
Accession A0A372RA02    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-193KELFEHKDDKKHMRKRNKKNSEYKNLKFDLBasic
NLS Segment(s)
PositionSequence
161-182KKEKELFEHKDDKKHMRKRNKK
Subcellular Location(s) nucl 8, E.R. 6, pero 3, golg 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MIKVCLNCFLIAYVTILFERYYLNEMAYQKVKEKVNEIRKLKSELTKIEEELSEHDKVVNENFEKTYRLRTKEDDKKYKSKIYDEAEKWYKKNSECENLKFKQEESIDSLIKYATRKRDYWNDAILHAENRDFDEPLLKMPCQKIKETIIEIRKLKSELTKKEKELFEHKDDKKHMRKRNKKNSEYKNLKFDLEKLIEYLIICEMQKRDFWEDAIFHAENRNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.09
6 0.1
7 0.1
8 0.13
9 0.12
10 0.13
11 0.18
12 0.19
13 0.24
14 0.27
15 0.27
16 0.28
17 0.34
18 0.37
19 0.34
20 0.39
21 0.44
22 0.5
23 0.58
24 0.59
25 0.59
26 0.59
27 0.62
28 0.6
29 0.57
30 0.53
31 0.48
32 0.5
33 0.46
34 0.43
35 0.4
36 0.35
37 0.29
38 0.27
39 0.26
40 0.21
41 0.18
42 0.18
43 0.17
44 0.17
45 0.18
46 0.2
47 0.17
48 0.19
49 0.2
50 0.2
51 0.22
52 0.22
53 0.3
54 0.31
55 0.35
56 0.36
57 0.4
58 0.49
59 0.57
60 0.67
61 0.67
62 0.67
63 0.71
64 0.73
65 0.74
66 0.67
67 0.61
68 0.58
69 0.53
70 0.56
71 0.49
72 0.52
73 0.53
74 0.52
75 0.48
76 0.45
77 0.44
78 0.37
79 0.43
80 0.4
81 0.43
82 0.46
83 0.51
84 0.54
85 0.5
86 0.51
87 0.44
88 0.39
89 0.35
90 0.31
91 0.27
92 0.24
93 0.26
94 0.23
95 0.22
96 0.22
97 0.15
98 0.16
99 0.16
100 0.15
101 0.19
102 0.22
103 0.24
104 0.28
105 0.37
106 0.41
107 0.44
108 0.45
109 0.38
110 0.35
111 0.35
112 0.32
113 0.23
114 0.19
115 0.15
116 0.1
117 0.11
118 0.12
119 0.1
120 0.09
121 0.12
122 0.11
123 0.14
124 0.16
125 0.14
126 0.16
127 0.19
128 0.26
129 0.25
130 0.26
131 0.28
132 0.3
133 0.34
134 0.35
135 0.39
136 0.38
137 0.42
138 0.42
139 0.39
140 0.38
141 0.34
142 0.32
143 0.33
144 0.36
145 0.39
146 0.46
147 0.52
148 0.53
149 0.6
150 0.61
151 0.58
152 0.59
153 0.56
154 0.55
155 0.58
156 0.58
157 0.58
158 0.61
159 0.66
160 0.67
161 0.7
162 0.72
163 0.74
164 0.81
165 0.85
166 0.91
167 0.92
168 0.91
169 0.92
170 0.93
171 0.93
172 0.92
173 0.87
174 0.85
175 0.76
176 0.68
177 0.59
178 0.51
179 0.49
180 0.41
181 0.36
182 0.27
183 0.26
184 0.24
185 0.23
186 0.21
187 0.13
188 0.12
189 0.12
190 0.14
191 0.16
192 0.16
193 0.19
194 0.23
195 0.27
196 0.27
197 0.29
198 0.3
199 0.29
200 0.3
201 0.34
202 0.29
203 0.24