Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QF89

Protein Details
Accession A0A372QF89   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41PPSEENWLRRIKKRNKKRKRLPHLPPGIPGBasic
NLS Segment(s)
PositionSequence
20-34RRIKKRNKKRKRLPH
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTCGEDPGGISPPSEENWLRRIKKRNKKRKRLPHLPPGIPGIRIYYRTTYNINLFDYKISHHDQSIINAPEFFFRRTPPPDNDSHITVSSDNSSHKSANDHVEASNSTTLLVTNNTHKSLIEDIDMTLYSPTPAHNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.27
5 0.36
6 0.4
7 0.46
8 0.56
9 0.62
10 0.71
11 0.79
12 0.84
13 0.86
14 0.91
15 0.95
16 0.95
17 0.95
18 0.95
19 0.93
20 0.93
21 0.91
22 0.83
23 0.74
24 0.68
25 0.59
26 0.48
27 0.39
28 0.32
29 0.24
30 0.24
31 0.24
32 0.21
33 0.22
34 0.23
35 0.25
36 0.24
37 0.25
38 0.25
39 0.25
40 0.23
41 0.21
42 0.19
43 0.17
44 0.15
45 0.16
46 0.16
47 0.15
48 0.14
49 0.17
50 0.17
51 0.18
52 0.23
53 0.21
54 0.18
55 0.18
56 0.18
57 0.17
58 0.18
59 0.18
60 0.12
61 0.12
62 0.18
63 0.23
64 0.28
65 0.3
66 0.32
67 0.34
68 0.39
69 0.4
70 0.37
71 0.33
72 0.29
73 0.26
74 0.22
75 0.2
76 0.16
77 0.14
78 0.13
79 0.14
80 0.15
81 0.15
82 0.15
83 0.17
84 0.2
85 0.24
86 0.25
87 0.23
88 0.21
89 0.23
90 0.23
91 0.23
92 0.2
93 0.15
94 0.13
95 0.11
96 0.11
97 0.1
98 0.12
99 0.11
100 0.17
101 0.21
102 0.22
103 0.23
104 0.23
105 0.24
106 0.25
107 0.25
108 0.2
109 0.17
110 0.16
111 0.17
112 0.17
113 0.15
114 0.12
115 0.1
116 0.09
117 0.09