Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QK36

Protein Details
Accession A0A372QK36    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVNPVKKVKIVKKRIKPFIRHQSDRYHydrophilic
30-49KEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
6-49KKVKIVKKRIKPFIRHQSDRYKSVKEAWRKPKGIDNRVRRRFKG
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVNPVKKVKIVKKRIKPFIRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQFLMPKIGYGSNKKTRHLMPNGFKKFLVSNIRELELLLMHNKTYAAEIAHNVSSRNRIAIIDRAQQLNIRVTNAKARVRSQEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.88
5 0.88
6 0.88
7 0.83
8 0.79
9 0.8
10 0.76
11 0.75
12 0.68
13 0.61
14 0.53
15 0.55
16 0.57
17 0.56
18 0.6
19 0.63
20 0.69
21 0.66
22 0.67
23 0.67
24 0.69
25 0.69
26 0.68
27 0.69
28 0.7
29 0.78
30 0.82
31 0.76
32 0.75
33 0.71
34 0.68
35 0.66
36 0.62
37 0.61
38 0.6
39 0.64
40 0.55
41 0.49
42 0.43
43 0.37
44 0.32
45 0.27
46 0.3
47 0.33
48 0.35
49 0.36
50 0.39
51 0.4
52 0.45
53 0.48
54 0.48
55 0.47
56 0.55
57 0.58
58 0.55
59 0.51
60 0.44
61 0.38
62 0.36
63 0.35
64 0.26
65 0.28
66 0.28
67 0.29
68 0.28
69 0.27
70 0.21
71 0.14
72 0.13
73 0.1
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.12
85 0.14
86 0.15
87 0.15
88 0.15
89 0.18
90 0.18
91 0.18
92 0.16
93 0.15
94 0.17
95 0.24
96 0.28
97 0.31
98 0.33
99 0.34
100 0.34
101 0.35
102 0.35
103 0.34
104 0.3
105 0.26
106 0.25
107 0.26
108 0.34
109 0.39
110 0.41
111 0.4
112 0.43
113 0.47