Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QF07

Protein Details
Accession A0A372QF07    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSRWRGRRRRKGKGKEKEYILSBasic
NLS Segment(s)
PositionSequence
4-17WRGRRRRKGKGKEK
Subcellular Location(s) nucl 16, mito_nucl 13.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSRWRGRRRRKGKGKEKEYILSPSPSLSPSPSCHSPSYPTYCITNHDDNSISNELKKMNLNNLEREEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.84
4 0.77
5 0.7
6 0.64
7 0.56
8 0.46
9 0.38
10 0.3
11 0.25
12 0.21
13 0.18
14 0.15
15 0.14
16 0.15
17 0.2
18 0.23
19 0.25
20 0.25
21 0.26
22 0.28
23 0.3
24 0.34
25 0.3
26 0.28
27 0.27
28 0.26
29 0.29
30 0.31
31 0.32
32 0.26
33 0.27
34 0.27
35 0.25
36 0.3
37 0.29
38 0.24
39 0.19
40 0.21
41 0.19
42 0.21
43 0.25
44 0.22
45 0.27
46 0.36
47 0.38
48 0.43
49 0.47