Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q8K9

Protein Details
Accession A0A372Q8K9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-35TNGRKDKVSQKKKASIKPKDBasic
NLS Segment(s)
PositionSequence
26-29KKKA
Subcellular Location(s) nucl 22, cyto_nucl 14.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MDNENDANSNGLNTVTNGRKDKVSQKKKASIKPKDESSSADKVANSFKDDTSRREFDLNKLVNITREAVMHPIYSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.24
4 0.27
5 0.28
6 0.3
7 0.33
8 0.42
9 0.47
10 0.53
11 0.56
12 0.62
13 0.69
14 0.75
15 0.8
16 0.8
17 0.79
18 0.77
19 0.74
20 0.72
21 0.65
22 0.58
23 0.54
24 0.48
25 0.42
26 0.35
27 0.3
28 0.24
29 0.22
30 0.25
31 0.22
32 0.19
33 0.17
34 0.16
35 0.22
36 0.24
37 0.28
38 0.32
39 0.33
40 0.32
41 0.36
42 0.37
43 0.35
44 0.43
45 0.4
46 0.34
47 0.34
48 0.33
49 0.3
50 0.31
51 0.28
52 0.19
53 0.18
54 0.18
55 0.19
56 0.19