Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q2H1

Protein Details
Accession A0A372Q2H1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
109-129PKKGNMSKKLSKKKIRSLLSKHydrophilic
NLS Segment(s)
PositionSequence
109-124PKKGNMSKKLSKKKIR
Subcellular Location(s) cyto 17, cyto_nucl 14, nucl 9
Family & Domain DBs
Amino Acid Sequences MSEKELSDIGDIYRKSLEAHKEYEACLTTTIYGDTYLDPEKCKARGFDPIKAFKEEEERTTLSLEWIERTTKEKGFRAQFQEWLDKAPPEFVDKDPKSLAYFDNLGGPPKKGNMSKKLSKKKIRSLLSKASHFVDCKIKFDDGVCVKVVKVISVKMDKDGVFLKVEDKVGDELEYYEIMYQQDMKITYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.24
4 0.31
5 0.29
6 0.33
7 0.37
8 0.37
9 0.37
10 0.4
11 0.35
12 0.27
13 0.24
14 0.21
15 0.16
16 0.15
17 0.15
18 0.11
19 0.1
20 0.1
21 0.09
22 0.11
23 0.14
24 0.15
25 0.16
26 0.18
27 0.22
28 0.23
29 0.26
30 0.25
31 0.24
32 0.33
33 0.36
34 0.41
35 0.46
36 0.52
37 0.52
38 0.53
39 0.51
40 0.41
41 0.45
42 0.39
43 0.33
44 0.3
45 0.28
46 0.25
47 0.26
48 0.25
49 0.17
50 0.17
51 0.15
52 0.12
53 0.12
54 0.12
55 0.12
56 0.16
57 0.19
58 0.21
59 0.25
60 0.27
61 0.33
62 0.37
63 0.41
64 0.45
65 0.43
66 0.44
67 0.42
68 0.44
69 0.37
70 0.35
71 0.3
72 0.23
73 0.21
74 0.18
75 0.16
76 0.13
77 0.15
78 0.13
79 0.23
80 0.23
81 0.25
82 0.24
83 0.24
84 0.22
85 0.21
86 0.2
87 0.12
88 0.13
89 0.11
90 0.15
91 0.15
92 0.17
93 0.16
94 0.16
95 0.15
96 0.15
97 0.19
98 0.19
99 0.26
100 0.32
101 0.39
102 0.47
103 0.57
104 0.66
105 0.72
106 0.76
107 0.78
108 0.79
109 0.81
110 0.8
111 0.78
112 0.75
113 0.75
114 0.72
115 0.67
116 0.59
117 0.52
118 0.47
119 0.4
120 0.35
121 0.35
122 0.29
123 0.3
124 0.31
125 0.28
126 0.26
127 0.26
128 0.32
129 0.25
130 0.26
131 0.24
132 0.21
133 0.21
134 0.23
135 0.22
136 0.16
137 0.15
138 0.14
139 0.19
140 0.24
141 0.25
142 0.24
143 0.28
144 0.26
145 0.27
146 0.27
147 0.23
148 0.19
149 0.19
150 0.18
151 0.18
152 0.19
153 0.17
154 0.17
155 0.16
156 0.16
157 0.16
158 0.15
159 0.12
160 0.13
161 0.13
162 0.11
163 0.1
164 0.11
165 0.1
166 0.11
167 0.12
168 0.11
169 0.15