Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QCR8

Protein Details
Accession A0A372QCR8   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MNKPLKPSIPKRKNSLKKQWDKTTKVVNVHydrophilic
NLS Segment(s)
PositionSequence
11-13KRK
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001589  Actinin_actin-bd_CS  
IPR001715  CH_dom  
IPR036872  CH_dom_sf  
Gene Ontology GO:0003779  F:actin binding  
GO:0016043  P:cellular component organization  
Pfam View protein in Pfam  
PF00307  CH  
PROSITE View protein in PROSITE  
PS00019  ACTININ_1  
PS50021  CH  
Amino Acid Sequences MNKPLKPSIPKRKNSLKKQWDKTTKVVNVKQKIHSNVSDKYTELQIATFTKWVNIQLRTIEEIPEINAIDKDFQDGKKLIELLELFYENDTEELPKPERGNSRVHYIQNVNKVLEFLQKKLDDNGLTALKAIGPVDIVDGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.87
5 0.9
6 0.92
7 0.91
8 0.86
9 0.82
10 0.81
11 0.78
12 0.77
13 0.74
14 0.72
15 0.71
16 0.71
17 0.71
18 0.68
19 0.65
20 0.61
21 0.6
22 0.55
23 0.51
24 0.49
25 0.43
26 0.36
27 0.33
28 0.29
29 0.24
30 0.19
31 0.14
32 0.12
33 0.13
34 0.13
35 0.13
36 0.11
37 0.11
38 0.12
39 0.16
40 0.18
41 0.18
42 0.18
43 0.18
44 0.2
45 0.22
46 0.21
47 0.18
48 0.14
49 0.13
50 0.12
51 0.11
52 0.1
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.09
59 0.1
60 0.1
61 0.13
62 0.13
63 0.13
64 0.14
65 0.15
66 0.12
67 0.13
68 0.13
69 0.11
70 0.12
71 0.12
72 0.1
73 0.1
74 0.1
75 0.07
76 0.07
77 0.06
78 0.07
79 0.08
80 0.11
81 0.13
82 0.16
83 0.17
84 0.22
85 0.28
86 0.29
87 0.35
88 0.34
89 0.4
90 0.43
91 0.43
92 0.43
93 0.43
94 0.45
95 0.46
96 0.47
97 0.39
98 0.34
99 0.33
100 0.29
101 0.32
102 0.29
103 0.22
104 0.27
105 0.28
106 0.3
107 0.32
108 0.36
109 0.28
110 0.27
111 0.31
112 0.25
113 0.23
114 0.22
115 0.2
116 0.15
117 0.15
118 0.14
119 0.08
120 0.07
121 0.07