Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QA38

Protein Details
Accession A0A372QA38    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-120DIQQRFGKLRPKNKIKNFWYSRLRRHQNDQYSYYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MPLFDDTSKNIILNFKIQHGYDSNDYVGISRLIPPFTPKQIRHFWTNILDPRLNHSCLDKEEEDYTVTWIENRVLNGPINWGELINDIQQRFGKLRPKNKIKNFWYSRLRRHQNDQYSYYHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.27
4 0.27
5 0.28
6 0.27
7 0.3
8 0.26
9 0.27
10 0.23
11 0.21
12 0.2
13 0.18
14 0.17
15 0.13
16 0.1
17 0.12
18 0.14
19 0.14
20 0.14
21 0.18
22 0.21
23 0.28
24 0.35
25 0.33
26 0.38
27 0.46
28 0.49
29 0.5
30 0.47
31 0.43
32 0.4
33 0.43
34 0.41
35 0.37
36 0.36
37 0.3
38 0.34
39 0.34
40 0.31
41 0.26
42 0.23
43 0.21
44 0.2
45 0.25
46 0.19
47 0.17
48 0.17
49 0.17
50 0.17
51 0.15
52 0.14
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.1
61 0.11
62 0.12
63 0.12
64 0.13
65 0.13
66 0.12
67 0.12
68 0.1
69 0.09
70 0.1
71 0.11
72 0.12
73 0.15
74 0.14
75 0.16
76 0.17
77 0.19
78 0.19
79 0.23
80 0.29
81 0.34
82 0.43
83 0.52
84 0.62
85 0.7
86 0.78
87 0.84
88 0.81
89 0.84
90 0.81
91 0.8
92 0.8
93 0.78
94 0.78
95 0.79
96 0.83
97 0.78
98 0.81
99 0.82
100 0.82
101 0.81
102 0.75