Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QFA6

Protein Details
Accession A0A372QFA6   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
190-209NPSQDRKSTRKDKISKPESIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004808  AP_endonuc_1  
IPR036691  Endo/exonu/phosph_ase_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0004527  F:exonuclease activity  
GO:0006281  P:DNA repair  
Amino Acid Sequences MVFICISNIPNSLYNYIAPPKNEGFSLKLLTLNARGLCDMSKNAWLGFEIIKNWDLVGLSETKISEKQIKSEKINPKSIYERYFGYKTHWNYSKTSSSRSSGTAFIYNKALEQYFESIESDNDGRAIMIRFKINNTYLRIIQLYCKTNQRNIKSCTNVDNLKDLILEWVNKGIKENERIIVMGDQNAALNPSQDRKSTRKDKISKPESILIKKLVNEIKLIDIFALRKKDKNVMTYKDISRLDYILLDKKLISNLSDKGIIKNDELKLYTDHAALYLELSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.3
4 0.31
5 0.29
6 0.31
7 0.32
8 0.32
9 0.33
10 0.31
11 0.27
12 0.27
13 0.29
14 0.25
15 0.24
16 0.23
17 0.24
18 0.25
19 0.26
20 0.23
21 0.21
22 0.2
23 0.19
24 0.19
25 0.19
26 0.18
27 0.16
28 0.19
29 0.19
30 0.19
31 0.18
32 0.18
33 0.17
34 0.17
35 0.17
36 0.14
37 0.16
38 0.16
39 0.16
40 0.15
41 0.14
42 0.12
43 0.1
44 0.11
45 0.1
46 0.1
47 0.11
48 0.12
49 0.13
50 0.14
51 0.16
52 0.22
53 0.21
54 0.28
55 0.36
56 0.41
57 0.45
58 0.53
59 0.6
60 0.59
61 0.67
62 0.62
63 0.57
64 0.58
65 0.58
66 0.52
67 0.44
68 0.39
69 0.36
70 0.37
71 0.32
72 0.3
73 0.33
74 0.33
75 0.39
76 0.43
77 0.4
78 0.41
79 0.46
80 0.5
81 0.45
82 0.46
83 0.41
84 0.37
85 0.37
86 0.36
87 0.33
88 0.25
89 0.25
90 0.26
91 0.24
92 0.23
93 0.23
94 0.2
95 0.19
96 0.18
97 0.16
98 0.1
99 0.11
100 0.12
101 0.1
102 0.11
103 0.11
104 0.1
105 0.1
106 0.11
107 0.1
108 0.08
109 0.07
110 0.07
111 0.06
112 0.07
113 0.08
114 0.08
115 0.09
116 0.11
117 0.11
118 0.12
119 0.16
120 0.17
121 0.21
122 0.23
123 0.23
124 0.22
125 0.23
126 0.23
127 0.19
128 0.2
129 0.21
130 0.2
131 0.2
132 0.27
133 0.27
134 0.33
135 0.4
136 0.42
137 0.45
138 0.48
139 0.53
140 0.5
141 0.5
142 0.48
143 0.45
144 0.42
145 0.35
146 0.33
147 0.26
148 0.22
149 0.2
150 0.16
151 0.13
152 0.12
153 0.11
154 0.08
155 0.13
156 0.14
157 0.14
158 0.15
159 0.17
160 0.2
161 0.23
162 0.25
163 0.22
164 0.21
165 0.22
166 0.21
167 0.2
168 0.16
169 0.13
170 0.11
171 0.1
172 0.09
173 0.09
174 0.09
175 0.06
176 0.07
177 0.07
178 0.11
179 0.13
180 0.16
181 0.21
182 0.26
183 0.36
184 0.45
185 0.53
186 0.59
187 0.66
188 0.73
189 0.79
190 0.8
191 0.76
192 0.71
193 0.69
194 0.66
195 0.61
196 0.55
197 0.48
198 0.44
199 0.39
200 0.41
201 0.37
202 0.31
203 0.28
204 0.26
205 0.26
206 0.23
207 0.22
208 0.16
209 0.14
210 0.15
211 0.19
212 0.26
213 0.24
214 0.28
215 0.31
216 0.39
217 0.41
218 0.48
219 0.52
220 0.5
221 0.55
222 0.58
223 0.57
224 0.58
225 0.54
226 0.48
227 0.41
228 0.35
229 0.3
230 0.25
231 0.27
232 0.25
233 0.25
234 0.23
235 0.22
236 0.23
237 0.25
238 0.23
239 0.22
240 0.19
241 0.21
242 0.24
243 0.29
244 0.28
245 0.29
246 0.34
247 0.34
248 0.33
249 0.38
250 0.37
251 0.36
252 0.37
253 0.35
254 0.31
255 0.33
256 0.32
257 0.25
258 0.22
259 0.18
260 0.18
261 0.16