Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R0K9

Protein Details
Accession A0A372R0K9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
63-90CMSHYSRVIRERRKRRELRRKTNALYPFHydrophilic
NLS Segment(s)
PositionSequence
72-83RERRKRRELRRK
Subcellular Location(s) plas 11, E.R. 7, mito 3, extr 3, golg 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDKYPSFPSSEPNHAISFYILLIQIVSSAILIMNYRCEVNNDNTISNFEKPTSLDNATSAQSCMSHYSRVIRERRKRRELRRKTNALYPFVRLSVQVTNNPLVNDFFNGSSFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.28
4 0.22
5 0.15
6 0.13
7 0.1
8 0.08
9 0.08
10 0.07
11 0.06
12 0.05
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.06
21 0.07
22 0.08
23 0.08
24 0.1
25 0.13
26 0.17
27 0.23
28 0.23
29 0.23
30 0.23
31 0.25
32 0.25
33 0.23
34 0.2
35 0.14
36 0.13
37 0.13
38 0.15
39 0.16
40 0.15
41 0.14
42 0.14
43 0.15
44 0.15
45 0.15
46 0.13
47 0.09
48 0.08
49 0.08
50 0.11
51 0.11
52 0.12
53 0.12
54 0.17
55 0.22
56 0.29
57 0.37
58 0.43
59 0.52
60 0.62
61 0.72
62 0.77
63 0.83
64 0.87
65 0.9
66 0.91
67 0.92
68 0.92
69 0.91
70 0.84
71 0.82
72 0.77
73 0.72
74 0.62
75 0.55
76 0.47
77 0.38
78 0.35
79 0.27
80 0.24
81 0.24
82 0.26
83 0.25
84 0.27
85 0.28
86 0.3
87 0.3
88 0.28
89 0.23
90 0.21
91 0.2
92 0.18
93 0.17