Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q108

Protein Details
Accession A0A372Q108    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKTGSRTSSTRPKRGRPKNILFEQSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005634  C:nucleus  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MKTGSRTSSTRPKRGRPKNILFEQSSNELHQTLSNDTPPKIEFQESIPPSEDEQEQEGREKTKNVEHKNENEFEKDTNMEQDLEEEEYEEAVDYIENYFDDGDYDVFDDDGGEGEGEAYFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.88
4 0.89
5 0.89
6 0.88
7 0.85
8 0.78
9 0.69
10 0.62
11 0.56
12 0.47
13 0.38
14 0.31
15 0.24
16 0.2
17 0.19
18 0.18
19 0.16
20 0.16
21 0.2
22 0.21
23 0.21
24 0.22
25 0.21
26 0.21
27 0.2
28 0.19
29 0.16
30 0.17
31 0.26
32 0.25
33 0.26
34 0.25
35 0.24
36 0.23
37 0.24
38 0.21
39 0.13
40 0.15
41 0.15
42 0.13
43 0.15
44 0.15
45 0.15
46 0.16
47 0.16
48 0.15
49 0.2
50 0.28
51 0.31
52 0.38
53 0.4
54 0.46
55 0.5
56 0.52
57 0.47
58 0.41
59 0.37
60 0.3
61 0.27
62 0.22
63 0.18
64 0.15
65 0.15
66 0.13
67 0.11
68 0.12
69 0.11
70 0.11
71 0.1
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.05
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.05
100 0.05
101 0.06