Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RTE5

Protein Details
Accession A0A372RTE5   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-35IVCNTTNKKTSLKKKKPKNIFFLYRDEHydrophilic
NLS Segment(s)
PositionSequence
21-25KKKKP
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MSTNKLHVIVCNTTNKKTSLKKKKPKNIFFLYRDEMMPFRPYGMPMCDYNRIIRDKWIELSDEEKNRYRLIYEINRDVTEDIEQTSSQTKEAQNSCAACTACGISIENSEICNTCVEQLYQIDSMYSYDHCKLCSSFSGNSRICIVCYEQNTHRYNTFFDNGEIPKDYGPNYDTNYPSEGILGLADRDYIDYDNYITFEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.48
4 0.53
5 0.59
6 0.6
7 0.68
8 0.74
9 0.82
10 0.89
11 0.93
12 0.92
13 0.91
14 0.9
15 0.88
16 0.82
17 0.79
18 0.73
19 0.64
20 0.55
21 0.47
22 0.37
23 0.3
24 0.28
25 0.2
26 0.18
27 0.17
28 0.17
29 0.18
30 0.21
31 0.21
32 0.21
33 0.25
34 0.28
35 0.28
36 0.3
37 0.32
38 0.33
39 0.31
40 0.34
41 0.34
42 0.31
43 0.33
44 0.31
45 0.27
46 0.24
47 0.28
48 0.29
49 0.29
50 0.3
51 0.31
52 0.31
53 0.3
54 0.29
55 0.26
56 0.21
57 0.25
58 0.29
59 0.29
60 0.33
61 0.35
62 0.34
63 0.34
64 0.32
65 0.25
66 0.18
67 0.14
68 0.1
69 0.09
70 0.09
71 0.09
72 0.12
73 0.11
74 0.1
75 0.13
76 0.13
77 0.18
78 0.2
79 0.21
80 0.21
81 0.22
82 0.22
83 0.23
84 0.22
85 0.16
86 0.15
87 0.13
88 0.1
89 0.1
90 0.09
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.07
101 0.07
102 0.08
103 0.08
104 0.09
105 0.09
106 0.11
107 0.1
108 0.1
109 0.09
110 0.08
111 0.09
112 0.08
113 0.09
114 0.09
115 0.12
116 0.13
117 0.14
118 0.15
119 0.15
120 0.16
121 0.19
122 0.21
123 0.21
124 0.25
125 0.34
126 0.32
127 0.33
128 0.34
129 0.31
130 0.27
131 0.24
132 0.24
133 0.19
134 0.21
135 0.26
136 0.27
137 0.35
138 0.37
139 0.38
140 0.38
141 0.34
142 0.34
143 0.34
144 0.33
145 0.26
146 0.25
147 0.28
148 0.26
149 0.27
150 0.27
151 0.23
152 0.21
153 0.21
154 0.2
155 0.18
156 0.19
157 0.2
158 0.22
159 0.27
160 0.28
161 0.29
162 0.3
163 0.28
164 0.26
165 0.22
166 0.18
167 0.12
168 0.11
169 0.1
170 0.08
171 0.07
172 0.07
173 0.07
174 0.08
175 0.09
176 0.1
177 0.1
178 0.1
179 0.12
180 0.12
181 0.13