Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q0N6

Protein Details
Accession A0A372Q0N6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTRNNNKKRNLNKKKVENNKSISRVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MTRNNNKKRNLNKKKVENNKSISRVKHEYWNILNFPTIDLDIIKKWDVQKLIYHLKVMFSVEGYCRKDLFNKESEYKFRLKQIDGKTFLKMTRIDFFKMGISGLLILHLEAEILRLHGYYNNENYYEPEELLLKFNDLEQKPYLLRNNNISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.94
3 0.92
4 0.89
5 0.86
6 0.84
7 0.82
8 0.77
9 0.7
10 0.67
11 0.64
12 0.57
13 0.59
14 0.53
15 0.52
16 0.51
17 0.53
18 0.46
19 0.41
20 0.4
21 0.3
22 0.27
23 0.22
24 0.16
25 0.11
26 0.1
27 0.11
28 0.1
29 0.12
30 0.12
31 0.13
32 0.15
33 0.18
34 0.19
35 0.19
36 0.22
37 0.27
38 0.33
39 0.32
40 0.32
41 0.29
42 0.28
43 0.27
44 0.24
45 0.17
46 0.1
47 0.1
48 0.11
49 0.17
50 0.18
51 0.18
52 0.18
53 0.18
54 0.23
55 0.26
56 0.28
57 0.27
58 0.28
59 0.32
60 0.34
61 0.36
62 0.35
63 0.34
64 0.31
65 0.31
66 0.3
67 0.27
68 0.33
69 0.37
70 0.42
71 0.44
72 0.44
73 0.4
74 0.39
75 0.38
76 0.33
77 0.28
78 0.22
79 0.23
80 0.24
81 0.24
82 0.23
83 0.23
84 0.21
85 0.19
86 0.17
87 0.1
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.09
105 0.13
106 0.17
107 0.21
108 0.23
109 0.24
110 0.24
111 0.26
112 0.27
113 0.25
114 0.2
115 0.17
116 0.17
117 0.17
118 0.19
119 0.17
120 0.14
121 0.13
122 0.15
123 0.23
124 0.22
125 0.25
126 0.24
127 0.28
128 0.28
129 0.35
130 0.4
131 0.39
132 0.43