Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QWQ1

Protein Details
Accession A0A372QWQ1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-60RQNSSTQHSKNNKSHKKRKNREQEQNKNKRNNLPTHydrophilic
NLS Segment(s)
PositionSequence
37-47NKSHKKRKNRE
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MVRKIKNTGNNVPEIVFSLVPPEGQRQNSSTQHSKNNKSHKKRKNREQEQNKNKRNNLPTIIITDLSDDVQDKGLTNSNSISNSNKKFPKNIINIEDNEIISTNHDFVDFEYTFNENQNISNGSSNNFNNKQQKKEESIKNKNLLLNNSSSKNLKANQLWKFLKRKFLIKGYDLQSIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.21
4 0.16
5 0.15
6 0.14
7 0.14
8 0.15
9 0.17
10 0.2
11 0.23
12 0.25
13 0.25
14 0.33
15 0.37
16 0.43
17 0.46
18 0.46
19 0.54
20 0.6
21 0.66
22 0.67
23 0.73
24 0.77
25 0.8
26 0.85
27 0.85
28 0.88
29 0.9
30 0.92
31 0.92
32 0.93
33 0.93
34 0.94
35 0.95
36 0.94
37 0.95
38 0.93
39 0.9
40 0.84
41 0.81
42 0.75
43 0.7
44 0.63
45 0.56
46 0.48
47 0.43
48 0.39
49 0.31
50 0.26
51 0.2
52 0.16
53 0.12
54 0.11
55 0.08
56 0.07
57 0.08
58 0.08
59 0.07
60 0.08
61 0.12
62 0.12
63 0.12
64 0.13
65 0.13
66 0.15
67 0.15
68 0.18
69 0.2
70 0.23
71 0.28
72 0.33
73 0.32
74 0.34
75 0.37
76 0.42
77 0.42
78 0.45
79 0.43
80 0.41
81 0.4
82 0.41
83 0.38
84 0.29
85 0.23
86 0.18
87 0.13
88 0.11
89 0.1
90 0.07
91 0.06
92 0.07
93 0.06
94 0.06
95 0.13
96 0.13
97 0.12
98 0.13
99 0.14
100 0.15
101 0.16
102 0.16
103 0.1
104 0.1
105 0.12
106 0.12
107 0.12
108 0.15
109 0.14
110 0.14
111 0.19
112 0.19
113 0.25
114 0.27
115 0.32
116 0.4
117 0.44
118 0.5
119 0.52
120 0.57
121 0.56
122 0.63
123 0.66
124 0.67
125 0.72
126 0.75
127 0.73
128 0.71
129 0.68
130 0.63
131 0.58
132 0.5
133 0.46
134 0.42
135 0.39
136 0.38
137 0.35
138 0.33
139 0.34
140 0.34
141 0.35
142 0.38
143 0.44
144 0.47
145 0.56
146 0.59
147 0.62
148 0.68
149 0.65
150 0.67
151 0.64
152 0.65
153 0.63
154 0.66
155 0.65
156 0.59
157 0.64
158 0.58