Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RAT9

Protein Details
Accession A0A372RAT9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-88NIDERKKNNLRKKIHQTNKKRLFIKHydrophilic
NLS Segment(s)
PositionSequence
69-84KKNNLRKKIHQTNKKR
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MSPLSHLIRINSIITNSHIQFSKSLSHNHYTTKSTKYNNDNIHGHILYYLKEDKLSSKDFDWGNIDERKKNNLRKKIHQTNKKRLFIKRNIIQVNFDALEDFTEWLSNLRFKKWAPMFEGMKWQDIIQLNDEQLLEKGIKTFTVRSELLYYFNIIKAAKAEKDAKKESSGVSETKDDKDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.24
4 0.26
5 0.25
6 0.24
7 0.24
8 0.25
9 0.29
10 0.26
11 0.31
12 0.33
13 0.37
14 0.38
15 0.42
16 0.44
17 0.41
18 0.42
19 0.43
20 0.44
21 0.44
22 0.5
23 0.52
24 0.57
25 0.58
26 0.6
27 0.55
28 0.52
29 0.52
30 0.44
31 0.37
32 0.3
33 0.25
34 0.19
35 0.2
36 0.19
37 0.13
38 0.14
39 0.15
40 0.16
41 0.2
42 0.22
43 0.21
44 0.2
45 0.25
46 0.24
47 0.26
48 0.26
49 0.23
50 0.24
51 0.28
52 0.29
53 0.29
54 0.31
55 0.37
56 0.41
57 0.49
58 0.53
59 0.57
60 0.62
61 0.67
62 0.76
63 0.79
64 0.81
65 0.82
66 0.83
67 0.85
68 0.88
69 0.85
70 0.79
71 0.75
72 0.75
73 0.73
74 0.73
75 0.67
76 0.65
77 0.61
78 0.56
79 0.51
80 0.42
81 0.36
82 0.27
83 0.21
84 0.13
85 0.1
86 0.09
87 0.08
88 0.08
89 0.05
90 0.05
91 0.05
92 0.06
93 0.07
94 0.11
95 0.12
96 0.13
97 0.15
98 0.15
99 0.25
100 0.28
101 0.31
102 0.31
103 0.38
104 0.39
105 0.38
106 0.47
107 0.38
108 0.36
109 0.32
110 0.27
111 0.26
112 0.26
113 0.26
114 0.2
115 0.2
116 0.18
117 0.2
118 0.2
119 0.15
120 0.12
121 0.12
122 0.1
123 0.08
124 0.1
125 0.09
126 0.1
127 0.12
128 0.14
129 0.14
130 0.2
131 0.2
132 0.21
133 0.25
134 0.24
135 0.25
136 0.24
137 0.24
138 0.19
139 0.2
140 0.2
141 0.16
142 0.16
143 0.16
144 0.2
145 0.19
146 0.24
147 0.32
148 0.36
149 0.44
150 0.49
151 0.49
152 0.48
153 0.49
154 0.45
155 0.43
156 0.41
157 0.35
158 0.33
159 0.37
160 0.36
161 0.39