Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R304

Protein Details
Accession A0A372R304    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-77LWAVPKKKTSHSKKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
57-73KKKTSHSKKRMRSANKG
Subcellular Location(s) mito 12.5, cyto_mito 8.5, nucl 6, cyto 3.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MFLSKYISIYNHALISTSTSGPLSNFMQTFWKESQRNTGTLLGLAEILGPILWAVPKKKTSHSKKRMRSANKGLKDKTNIVNCPGCGQKHLTHHLCFNCYKNFNNIER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.18
4 0.15
5 0.14
6 0.13
7 0.14
8 0.13
9 0.17
10 0.14
11 0.14
12 0.14
13 0.14
14 0.19
15 0.19
16 0.23
17 0.23
18 0.3
19 0.28
20 0.29
21 0.39
22 0.36
23 0.37
24 0.35
25 0.35
26 0.27
27 0.25
28 0.24
29 0.14
30 0.11
31 0.1
32 0.07
33 0.04
34 0.04
35 0.03
36 0.02
37 0.02
38 0.02
39 0.03
40 0.04
41 0.06
42 0.09
43 0.13
44 0.15
45 0.23
46 0.33
47 0.43
48 0.53
49 0.63
50 0.7
51 0.76
52 0.83
53 0.86
54 0.83
55 0.83
56 0.82
57 0.82
58 0.8
59 0.79
60 0.72
61 0.69
62 0.66
63 0.61
64 0.57
65 0.55
66 0.48
67 0.45
68 0.46
69 0.4
70 0.39
71 0.38
72 0.31
73 0.26
74 0.29
75 0.3
76 0.34
77 0.43
78 0.44
79 0.43
80 0.49
81 0.51
82 0.5
83 0.49
84 0.46
85 0.46
86 0.44
87 0.45
88 0.46