Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RJZ1

Protein Details
Accession A0A372RJZ1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-48THEKCEKREKRLTHRDRKKYNLYEBasic
NLS Segment(s)
Subcellular Location(s) nucl 25, mito_nucl 13.833, cyto_nucl 13.333
Family & Domain DBs
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
Amino Acid Sequences MHWKEISKLMNRSHDSVSKRYEKVTHEKCEKREKRLTHRDRKKYNLYENYDELQKLIDKYGRDWTKIAKIMNRSKNSVLKQHLFMEIGQKLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.5
4 0.51
5 0.49
6 0.47
7 0.46
8 0.46
9 0.46
10 0.52
11 0.54
12 0.56
13 0.58
14 0.63
15 0.66
16 0.72
17 0.72
18 0.7
19 0.7
20 0.69
21 0.7
22 0.75
23 0.8
24 0.79
25 0.84
26 0.86
27 0.85
28 0.84
29 0.83
30 0.79
31 0.77
32 0.75
33 0.7
34 0.64
35 0.59
36 0.53
37 0.45
38 0.37
39 0.28
40 0.2
41 0.15
42 0.12
43 0.11
44 0.13
45 0.12
46 0.14
47 0.24
48 0.25
49 0.26
50 0.26
51 0.29
52 0.33
53 0.37
54 0.38
55 0.34
56 0.4
57 0.48
58 0.57
59 0.57
60 0.54
61 0.56
62 0.61
63 0.6
64 0.6
65 0.58
66 0.53
67 0.53
68 0.51
69 0.49
70 0.42
71 0.38
72 0.37
73 0.3