Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RAV6

Protein Details
Accession A0A372RAV6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-107TYIQNKYKKWPPHYNKRMSLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
Amino Acid Sequences MSPNKKALSLFRRLWRAGDSSVLCSKPAVYYIRQRIREGFDEYKNVRNEIILNDLFERCENTIKFLETAAIRKGFEHKVVYVLCEMTYIQNKYKKWPPHYNKRMSLELYNSHAHSYDDYNLTVMMMNDSLKLCLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.5
3 0.47
4 0.39
5 0.39
6 0.33
7 0.31
8 0.35
9 0.33
10 0.29
11 0.26
12 0.25
13 0.19
14 0.21
15 0.19
16 0.19
17 0.28
18 0.38
19 0.46
20 0.49
21 0.5
22 0.5
23 0.52
24 0.51
25 0.49
26 0.44
27 0.38
28 0.42
29 0.42
30 0.45
31 0.41
32 0.38
33 0.31
34 0.26
35 0.24
36 0.19
37 0.22
38 0.15
39 0.15
40 0.15
41 0.15
42 0.15
43 0.14
44 0.14
45 0.09
46 0.14
47 0.13
48 0.15
49 0.16
50 0.16
51 0.16
52 0.15
53 0.16
54 0.12
55 0.14
56 0.13
57 0.13
58 0.12
59 0.12
60 0.17
61 0.16
62 0.18
63 0.18
64 0.16
65 0.18
66 0.18
67 0.19
68 0.16
69 0.15
70 0.12
71 0.11
72 0.11
73 0.1
74 0.15
75 0.16
76 0.2
77 0.26
78 0.26
79 0.32
80 0.4
81 0.46
82 0.5
83 0.59
84 0.64
85 0.7
86 0.8
87 0.83
88 0.83
89 0.8
90 0.76
91 0.68
92 0.62
93 0.56
94 0.49
95 0.44
96 0.38
97 0.34
98 0.29
99 0.26
100 0.23
101 0.2
102 0.2
103 0.2
104 0.19
105 0.19
106 0.19
107 0.18
108 0.17
109 0.16
110 0.13
111 0.11
112 0.09
113 0.09
114 0.11
115 0.12