Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q3R6

Protein Details
Accession A0A372Q3R6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
33-58LFIKDPKLKVHKKKYWKRRSSCMLIYHydrophilic
NLS Segment(s)
PositionSequence
40-50LKVHKKKYWKR
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MIHIIFQFITQASIKPEASAGSNKLQLSFNSTLFIKDPKLKVHKKKYWKRRSSCMLIYFKSIKSKMTGCHVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.15
5 0.17
6 0.19
7 0.18
8 0.18
9 0.22
10 0.22
11 0.23
12 0.23
13 0.21
14 0.25
15 0.24
16 0.21
17 0.19
18 0.19
19 0.18
20 0.17
21 0.19
22 0.14
23 0.16
24 0.17
25 0.22
26 0.31
27 0.39
28 0.48
29 0.58
30 0.64
31 0.71
32 0.79
33 0.84
34 0.86
35 0.88
36 0.85
37 0.84
38 0.85
39 0.82
40 0.8
41 0.77
42 0.73
43 0.64
44 0.63
45 0.57
46 0.51
47 0.51
48 0.44
49 0.37
50 0.34
51 0.37
52 0.35
53 0.41