Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RBN1

Protein Details
Accession A0A372RBN1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
94-121CEKSGHYQKKCPNAKKNNQYRGMKNRGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MKTDGELIKILKDFIAAKHEKQSEGDNANNILDYIANQSLGQDVTNPNVTKICGTSSKKRLKSVIELSKKKILMQENLNEPNNQIRSQRKCLLCEKSGHYQKKCPNAKKNNQYRGMKNRGVGDWKRTVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.24
3 0.24
4 0.25
5 0.33
6 0.36
7 0.35
8 0.35
9 0.37
10 0.35
11 0.37
12 0.36
13 0.3
14 0.29
15 0.28
16 0.26
17 0.22
18 0.15
19 0.1
20 0.08
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.09
29 0.07
30 0.08
31 0.1
32 0.15
33 0.15
34 0.15
35 0.15
36 0.15
37 0.14
38 0.14
39 0.14
40 0.17
41 0.22
42 0.3
43 0.39
44 0.48
45 0.51
46 0.53
47 0.54
48 0.49
49 0.52
50 0.53
51 0.53
52 0.53
53 0.53
54 0.53
55 0.55
56 0.52
57 0.46
58 0.41
59 0.35
60 0.31
61 0.33
62 0.34
63 0.35
64 0.4
65 0.4
66 0.36
67 0.32
68 0.33
69 0.31
70 0.27
71 0.25
72 0.29
73 0.34
74 0.42
75 0.49
76 0.46
77 0.49
78 0.55
79 0.57
80 0.53
81 0.51
82 0.49
83 0.52
84 0.58
85 0.62
86 0.58
87 0.6
88 0.63
89 0.68
90 0.73
91 0.72
92 0.74
93 0.76
94 0.83
95 0.86
96 0.9
97 0.9
98 0.89
99 0.87
100 0.86
101 0.85
102 0.84
103 0.77
104 0.7
105 0.65
106 0.61
107 0.62
108 0.57
109 0.54