Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QI76

Protein Details
Accession A0A372QI76    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
166-195VSSTFTKKSSSKKAKKTDKKKVSSMLKKFIHydrophilic
NLS Segment(s)
PositionSequence
172-188KKSSSKKAKKTDKKKVS
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences YRNLRYNILKSLNDKAVRDIDFPEMEVCFKCNNDILTFPLKEFTRLHCRHIFYRLCTEKKLMLNIPNPCSFPNCRKNVETTDIISTTLNYLIGRLPESNITIQDSPLFQSSGTSALTNMMSKRFILTSPPMHMEGLCPIYPSTDIEIDNIETPAEPNTVQKKHTRVSSTFTKKSSSKKAKKTDKKKVSSMLKKFIKELLADTLISTIGENLEEVNKSATSIFLQLSDKIDNAKTKNKSAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.45
4 0.44
5 0.42
6 0.36
7 0.33
8 0.29
9 0.29
10 0.26
11 0.2
12 0.19
13 0.18
14 0.18
15 0.15
16 0.15
17 0.16
18 0.17
19 0.19
20 0.19
21 0.2
22 0.22
23 0.27
24 0.27
25 0.26
26 0.28
27 0.26
28 0.28
29 0.28
30 0.31
31 0.35
32 0.37
33 0.43
34 0.44
35 0.48
36 0.48
37 0.55
38 0.53
39 0.46
40 0.55
41 0.57
42 0.53
43 0.51
44 0.5
45 0.47
46 0.45
47 0.47
48 0.4
49 0.39
50 0.43
51 0.47
52 0.48
53 0.44
54 0.42
55 0.38
56 0.38
57 0.35
58 0.38
59 0.41
60 0.42
61 0.44
62 0.45
63 0.49
64 0.49
65 0.5
66 0.43
67 0.35
68 0.33
69 0.29
70 0.28
71 0.23
72 0.18
73 0.14
74 0.12
75 0.1
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.09
83 0.09
84 0.11
85 0.11
86 0.11
87 0.13
88 0.12
89 0.12
90 0.12
91 0.11
92 0.11
93 0.11
94 0.1
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.07
101 0.06
102 0.07
103 0.08
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.09
110 0.08
111 0.08
112 0.1
113 0.14
114 0.15
115 0.17
116 0.19
117 0.19
118 0.19
119 0.19
120 0.16
121 0.14
122 0.15
123 0.12
124 0.11
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.11
137 0.09
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.11
144 0.18
145 0.21
146 0.23
147 0.28
148 0.32
149 0.35
150 0.41
151 0.42
152 0.37
153 0.41
154 0.49
155 0.53
156 0.53
157 0.5
158 0.5
159 0.48
160 0.54
161 0.6
162 0.6
163 0.61
164 0.66
165 0.75
166 0.81
167 0.88
168 0.91
169 0.91
170 0.91
171 0.88
172 0.85
173 0.84
174 0.84
175 0.84
176 0.8
177 0.79
178 0.76
179 0.7
180 0.65
181 0.59
182 0.51
183 0.41
184 0.36
185 0.31
186 0.26
187 0.24
188 0.23
189 0.19
190 0.16
191 0.15
192 0.13
193 0.07
194 0.06
195 0.06
196 0.06
197 0.06
198 0.08
199 0.09
200 0.1
201 0.12
202 0.11
203 0.12
204 0.12
205 0.12
206 0.11
207 0.13
208 0.13
209 0.14
210 0.16
211 0.18
212 0.21
213 0.21
214 0.2
215 0.22
216 0.25
217 0.29
218 0.32
219 0.39
220 0.41