Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R3J9

Protein Details
Accession A0A372R3J9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
74-95HDHKHGHKHGHKHGHKHGHGRYBasic
NLS Segment(s)
PositionSequence
79-92GHKHGHKHGHKHGH
Subcellular Location(s) extr 11, mito 9, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MQFNIVLFFLALFAVLSLGAAVRKNEENTVKRRSNDYDDDDGYGHKLRRRNDHDDHDDYDRYDKLRKRNDYDDHDHKHGHKHGHKHGHKHGHGRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.05
7 0.06
8 0.07
9 0.09
10 0.12
11 0.13
12 0.18
13 0.26
14 0.3
15 0.35
16 0.44
17 0.46
18 0.45
19 0.48
20 0.48
21 0.47
22 0.47
23 0.47
24 0.43
25 0.39
26 0.39
27 0.34
28 0.3
29 0.25
30 0.22
31 0.18
32 0.16
33 0.2
34 0.22
35 0.32
36 0.39
37 0.45
38 0.48
39 0.55
40 0.59
41 0.58
42 0.58
43 0.52
44 0.46
45 0.38
46 0.34
47 0.27
48 0.22
49 0.24
50 0.26
51 0.32
52 0.41
53 0.47
54 0.52
55 0.6
56 0.66
57 0.68
58 0.72
59 0.73
60 0.7
61 0.66
62 0.63
63 0.56
64 0.56
65 0.54
66 0.55
67 0.52
68 0.55
69 0.62
70 0.69
71 0.74
72 0.75
73 0.8
74 0.8
75 0.8