Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RRS2

Protein Details
Accession A0A372RRS2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
11-32LIIHGMKKWKVRHNRFVKISKLHydrophilic
102-130VKNYWNAKLKREKKFKNKGQKEIKYENHEHydrophilic
NLS Segment(s)
PositionSequence
96-122RHSENKVKNYWNAKLKREKKFKNKGQK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
Amino Acid Sequences MPLFDENSNKLIIHGMKKWKVRHNRFVKISKLVPNYTPKQIASHWKNYLDPNLCLDTLEYEEKKFIAEWIRKYRTSSGVIHWKYVVNDLKIRFGKRHSENKVKNYWNAKLKREKKFKNKGQKEIKYENHEQEKGKEMYTEGDERKFIFHFVSSEDFLPRRPSKITIASLLNFDNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.52
5 0.6
6 0.64
7 0.7
8 0.74
9 0.78
10 0.79
11 0.82
12 0.83
13 0.83
14 0.8
15 0.75
16 0.71
17 0.69
18 0.64
19 0.57
20 0.53
21 0.54
22 0.52
23 0.51
24 0.48
25 0.4
26 0.38
27 0.39
28 0.45
29 0.43
30 0.47
31 0.46
32 0.45
33 0.47
34 0.47
35 0.51
36 0.44
37 0.38
38 0.33
39 0.31
40 0.28
41 0.26
42 0.23
43 0.17
44 0.15
45 0.19
46 0.16
47 0.14
48 0.14
49 0.14
50 0.14
51 0.13
52 0.13
53 0.17
54 0.21
55 0.27
56 0.37
57 0.41
58 0.42
59 0.44
60 0.45
61 0.41
62 0.41
63 0.36
64 0.31
65 0.37
66 0.37
67 0.35
68 0.32
69 0.29
70 0.25
71 0.29
72 0.27
73 0.18
74 0.21
75 0.21
76 0.27
77 0.29
78 0.29
79 0.25
80 0.25
81 0.32
82 0.36
83 0.45
84 0.46
85 0.54
86 0.59
87 0.64
88 0.69
89 0.64
90 0.62
91 0.58
92 0.58
93 0.56
94 0.56
95 0.56
96 0.59
97 0.65
98 0.69
99 0.74
100 0.77
101 0.79
102 0.84
103 0.87
104 0.87
105 0.87
106 0.88
107 0.88
108 0.87
109 0.84
110 0.82
111 0.8
112 0.76
113 0.73
114 0.71
115 0.68
116 0.63
117 0.57
118 0.5
119 0.51
120 0.44
121 0.39
122 0.31
123 0.24
124 0.23
125 0.26
126 0.3
127 0.24
128 0.25
129 0.26
130 0.25
131 0.27
132 0.24
133 0.21
134 0.16
135 0.15
136 0.14
137 0.17
138 0.2
139 0.2
140 0.21
141 0.24
142 0.23
143 0.23
144 0.31
145 0.3
146 0.29
147 0.3
148 0.33
149 0.36
150 0.43
151 0.45
152 0.42
153 0.45
154 0.43
155 0.43