Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R8I5

Protein Details
Accession A0A372R8I5   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-110NNTAKKRSLKVYKKYYKRSDIPNHFRHVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, nucl 8, cyto_pero 7.5, pero 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011706  Cu-oxidase_C  
IPR033138  Cu_oxidase_CS  
IPR008972  Cupredoxin  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07731  Cu-oxidase_2  
PROSITE View protein in PROSITE  
PS00079  MULTICOPPER_OXIDASE1  
Amino Acid Sequences MGQGPGKTPDPTQFNLVDPAVRDTLTVAGDSWTVIRYFIDNPGIWALYSHIEWLIEMGMVGQLIERPSELKDNDDDDDDDDNNNTAKKRSLKVYKKYYKRSDIPNHFRHVRYKFMRGSAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.32
4 0.26
5 0.22
6 0.24
7 0.2
8 0.18
9 0.16
10 0.13
11 0.15
12 0.13
13 0.12
14 0.09
15 0.08
16 0.09
17 0.09
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.08
24 0.09
25 0.11
26 0.14
27 0.13
28 0.14
29 0.15
30 0.15
31 0.13
32 0.12
33 0.11
34 0.09
35 0.09
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.1
56 0.11
57 0.11
58 0.13
59 0.16
60 0.16
61 0.17
62 0.17
63 0.14
64 0.16
65 0.15
66 0.13
67 0.11
68 0.11
69 0.11
70 0.12
71 0.11
72 0.11
73 0.16
74 0.21
75 0.25
76 0.33
77 0.44
78 0.52
79 0.61
80 0.71
81 0.75
82 0.8
83 0.86
84 0.86
85 0.85
86 0.82
87 0.83
88 0.83
89 0.84
90 0.84
91 0.81
92 0.79
93 0.76
94 0.72
95 0.71
96 0.64
97 0.63
98 0.59
99 0.6
100 0.58