Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QJM0

Protein Details
Accession A0A372QJM0   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-91MLNRKAAARLRQKKKKEIKELQDSNIHydrophilic
NLS Segment(s)
PositionSequence
62-83ERKRMLNRKAAARLRQKKKKEI
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
Amino Acid Sequences MEKKESYEISEDNPLLKTSVFSTKDSSSEDIQQNQSLCKISSSSSRSSKFSNNIDKKILQNERKRMLNRKAAARLRQKKKKEIKELQDSNISXRXEIEQVESIIMKLRQQIMDLEIKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.17
5 0.13
6 0.22
7 0.23
8 0.23
9 0.27
10 0.28
11 0.3
12 0.32
13 0.32
14 0.25
15 0.3
16 0.32
17 0.32
18 0.32
19 0.33
20 0.3
21 0.28
22 0.27
23 0.22
24 0.18
25 0.15
26 0.14
27 0.12
28 0.19
29 0.22
30 0.26
31 0.32
32 0.34
33 0.35
34 0.37
35 0.41
36 0.39
37 0.42
38 0.47
39 0.45
40 0.46
41 0.47
42 0.46
43 0.42
44 0.45
45 0.46
46 0.43
47 0.45
48 0.5
49 0.52
50 0.56
51 0.58
52 0.59
53 0.59
54 0.6
55 0.57
56 0.56
57 0.6
58 0.6
59 0.65
60 0.67
61 0.7
62 0.72
63 0.77
64 0.76
65 0.78
66 0.82
67 0.84
68 0.84
69 0.84
70 0.82
71 0.84
72 0.82
73 0.76
74 0.74
75 0.65
76 0.57
77 0.54
78 0.45
79 0.34
80 0.31
81 0.29
82 0.21
83 0.21
84 0.17
85 0.12
86 0.11
87 0.12
88 0.14
89 0.13
90 0.13
91 0.17
92 0.22
93 0.21
94 0.22
95 0.24
96 0.24
97 0.31