Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q6S1

Protein Details
Accession A0A372Q6S1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
207-227GKLKKHGGDIKKKKFLSKKRKBasic
NLS Segment(s)
PositionSequence
207-227GKLKKHGGDIKKKKFLSKKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027973  DUF4602  
Pfam View protein in Pfam  
PF15375  DUF4602  
Amino Acid Sequences MTKNENAIATKIEPEVVIFNDGLLKKSLNKSGSSITEWKSFMSHKISKVNEKPQKSLSKNIVRSDEEINRKNDEELEELLKTTKLLEKYTTEQLSGKDRRKYVEQKVVELGAKPKKGVKIPTPISLEIQSKRQERERKELEEAKNLGLYHKSIKHQWASSSSSLSKSQKVRDKGIGMGIGKIKNGMLVLSSKDIKHVQNSRNGSNSGKLKKHGGDIKKKKFLSKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.15
4 0.15
5 0.13
6 0.12
7 0.17
8 0.18
9 0.18
10 0.17
11 0.17
12 0.2
13 0.26
14 0.32
15 0.29
16 0.3
17 0.32
18 0.36
19 0.38
20 0.38
21 0.38
22 0.35
23 0.38
24 0.36
25 0.34
26 0.31
27 0.29
28 0.28
29 0.32
30 0.33
31 0.33
32 0.41
33 0.44
34 0.51
35 0.58
36 0.64
37 0.64
38 0.63
39 0.62
40 0.62
41 0.68
42 0.62
43 0.63
44 0.62
45 0.63
46 0.65
47 0.65
48 0.63
49 0.55
50 0.54
51 0.51
52 0.49
53 0.47
54 0.46
55 0.44
56 0.41
57 0.4
58 0.38
59 0.34
60 0.28
61 0.23
62 0.2
63 0.2
64 0.17
65 0.16
66 0.16
67 0.15
68 0.12
69 0.11
70 0.13
71 0.12
72 0.13
73 0.15
74 0.18
75 0.22
76 0.29
77 0.28
78 0.25
79 0.25
80 0.25
81 0.32
82 0.36
83 0.38
84 0.36
85 0.37
86 0.39
87 0.45
88 0.5
89 0.5
90 0.52
91 0.47
92 0.44
93 0.44
94 0.43
95 0.36
96 0.29
97 0.27
98 0.22
99 0.22
100 0.2
101 0.21
102 0.23
103 0.26
104 0.3
105 0.29
106 0.34
107 0.36
108 0.42
109 0.43
110 0.4
111 0.38
112 0.36
113 0.35
114 0.26
115 0.28
116 0.28
117 0.28
118 0.3
119 0.36
120 0.41
121 0.43
122 0.51
123 0.53
124 0.51
125 0.55
126 0.61
127 0.56
128 0.56
129 0.52
130 0.43
131 0.39
132 0.34
133 0.29
134 0.22
135 0.2
136 0.17
137 0.21
138 0.22
139 0.24
140 0.29
141 0.32
142 0.33
143 0.35
144 0.34
145 0.35
146 0.34
147 0.35
148 0.31
149 0.29
150 0.33
151 0.33
152 0.34
153 0.34
154 0.41
155 0.45
156 0.49
157 0.51
158 0.51
159 0.51
160 0.47
161 0.46
162 0.42
163 0.34
164 0.33
165 0.32
166 0.26
167 0.24
168 0.22
169 0.18
170 0.15
171 0.14
172 0.11
173 0.08
174 0.09
175 0.11
176 0.15
177 0.18
178 0.16
179 0.2
180 0.24
181 0.25
182 0.33
183 0.39
184 0.4
185 0.47
186 0.53
187 0.54
188 0.55
189 0.55
190 0.48
191 0.47
192 0.51
193 0.5
194 0.5
195 0.48
196 0.5
197 0.51
198 0.58
199 0.59
200 0.6
201 0.63
202 0.69
203 0.76
204 0.79
205 0.79
206 0.8
207 0.81