Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RHI5

Protein Details
Accession A0A372RHI5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
225-251TNTFASEKRNIKRTRKNLRNTKSFGATHydrophilic
NLS Segment(s)
PositionSequence
200-209PPKAIAKPRK
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MRSDRRLKEKFGTMDYIKEKQFYQLTLSNELWLRNGKKYGQNCIGMDSKHDLNNDRTPVLVIITENNSGSETPLSFGISNKENQWTIKLSITVIKTNIPCNQDDCEYKWSYVDLPNDKGFKRIRECNSSNWNPLVMIDKHKHQKLPDKELFSRQVKEDLVTYFKNKERIIFSPKGNIPERNSDPFRPPELKYNTPNKGAPPKAIAKPRKSSRILQTLQSNSQNETNTFASEKRNIKRTRKNLRNTKSFGATVTSPHWEKTRMGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.53
4 0.45
5 0.42
6 0.38
7 0.37
8 0.38
9 0.31
10 0.32
11 0.32
12 0.34
13 0.38
14 0.37
15 0.34
16 0.33
17 0.32
18 0.29
19 0.3
20 0.3
21 0.29
22 0.33
23 0.34
24 0.41
25 0.45
26 0.52
27 0.51
28 0.54
29 0.49
30 0.5
31 0.49
32 0.41
33 0.39
34 0.34
35 0.3
36 0.27
37 0.29
38 0.29
39 0.3
40 0.37
41 0.36
42 0.32
43 0.29
44 0.27
45 0.25
46 0.22
47 0.17
48 0.11
49 0.11
50 0.13
51 0.14
52 0.13
53 0.13
54 0.13
55 0.12
56 0.13
57 0.11
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.11
64 0.13
65 0.14
66 0.15
67 0.16
68 0.19
69 0.19
70 0.19
71 0.21
72 0.21
73 0.21
74 0.21
75 0.2
76 0.17
77 0.21
78 0.22
79 0.21
80 0.19
81 0.21
82 0.2
83 0.23
84 0.27
85 0.24
86 0.23
87 0.23
88 0.24
89 0.24
90 0.24
91 0.25
92 0.25
93 0.25
94 0.24
95 0.22
96 0.2
97 0.19
98 0.22
99 0.24
100 0.22
101 0.24
102 0.27
103 0.29
104 0.29
105 0.32
106 0.3
107 0.3
108 0.32
109 0.37
110 0.39
111 0.45
112 0.47
113 0.48
114 0.55
115 0.53
116 0.49
117 0.42
118 0.37
119 0.28
120 0.26
121 0.25
122 0.17
123 0.19
124 0.18
125 0.23
126 0.29
127 0.31
128 0.33
129 0.31
130 0.4
131 0.42
132 0.51
133 0.5
134 0.51
135 0.51
136 0.54
137 0.58
138 0.52
139 0.46
140 0.37
141 0.36
142 0.29
143 0.28
144 0.24
145 0.19
146 0.19
147 0.19
148 0.2
149 0.21
150 0.23
151 0.28
152 0.27
153 0.29
154 0.29
155 0.33
156 0.39
157 0.39
158 0.37
159 0.4
160 0.42
161 0.45
162 0.44
163 0.43
164 0.39
165 0.42
166 0.46
167 0.45
168 0.46
169 0.43
170 0.45
171 0.44
172 0.46
173 0.42
174 0.39
175 0.41
176 0.45
177 0.48
178 0.51
179 0.56
180 0.55
181 0.56
182 0.56
183 0.52
184 0.54
185 0.5
186 0.45
187 0.42
188 0.44
189 0.46
190 0.54
191 0.57
192 0.55
193 0.63
194 0.68
195 0.71
196 0.69
197 0.7
198 0.69
199 0.71
200 0.66
201 0.62
202 0.63
203 0.59
204 0.61
205 0.59
206 0.51
207 0.43
208 0.45
209 0.42
210 0.34
211 0.33
212 0.28
213 0.24
214 0.24
215 0.23
216 0.24
217 0.3
218 0.38
219 0.4
220 0.48
221 0.56
222 0.65
223 0.74
224 0.79
225 0.83
226 0.84
227 0.89
228 0.9
229 0.91
230 0.91
231 0.86
232 0.82
233 0.77
234 0.67
235 0.58
236 0.52
237 0.43
238 0.36
239 0.33
240 0.34
241 0.29
242 0.31
243 0.33
244 0.31