Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QNF7

Protein Details
Accession A0A372QNF7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-66SNIGFNRKSKKIKVRKVNKNVALRKNTHydrophilic
NLS Segment(s)
PositionSequence
46-61RKSKKIKVRKVNKNVA
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, cyto 3
Family & Domain DBs
Amino Acid Sequences METKTHDFADNDIKDHEKIDDVKSVEEGKSTEDNESVKESNIGFNRKSKKIKVRKVNKNVALRKNTNKIHKTISEEASNYQDGDIPWKDLQPKMEEKFGKLRSRNSLKNVWNSNKRRNDRLAKEVKRNEDKIEDITEKMNQLAFPTNEPGTYTKQEKLELRYLLNKDYENDKNDDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.26
4 0.21
5 0.22
6 0.23
7 0.27
8 0.25
9 0.26
10 0.27
11 0.29
12 0.24
13 0.23
14 0.2
15 0.18
16 0.21
17 0.21
18 0.2
19 0.2
20 0.2
21 0.2
22 0.24
23 0.21
24 0.17
25 0.18
26 0.17
27 0.21
28 0.26
29 0.29
30 0.26
31 0.33
32 0.4
33 0.45
34 0.51
35 0.54
36 0.6
37 0.66
38 0.74
39 0.77
40 0.81
41 0.84
42 0.88
43 0.9
44 0.87
45 0.86
46 0.85
47 0.83
48 0.8
49 0.74
50 0.71
51 0.7
52 0.68
53 0.67
54 0.61
55 0.55
56 0.53
57 0.5
58 0.5
59 0.47
60 0.44
61 0.37
62 0.35
63 0.33
64 0.3
65 0.27
66 0.2
67 0.15
68 0.13
69 0.11
70 0.14
71 0.13
72 0.13
73 0.13
74 0.14
75 0.16
76 0.16
77 0.18
78 0.17
79 0.23
80 0.22
81 0.29
82 0.28
83 0.29
84 0.36
85 0.4
86 0.44
87 0.41
88 0.44
89 0.47
90 0.53
91 0.56
92 0.53
93 0.55
94 0.52
95 0.57
96 0.61
97 0.6
98 0.63
99 0.64
100 0.69
101 0.71
102 0.71
103 0.69
104 0.69
105 0.71
106 0.67
107 0.7
108 0.71
109 0.68
110 0.74
111 0.74
112 0.74
113 0.72
114 0.68
115 0.61
116 0.54
117 0.49
118 0.42
119 0.41
120 0.34
121 0.27
122 0.27
123 0.25
124 0.22
125 0.21
126 0.19
127 0.13
128 0.14
129 0.19
130 0.18
131 0.19
132 0.23
133 0.22
134 0.21
135 0.23
136 0.24
137 0.24
138 0.28
139 0.3
140 0.3
141 0.33
142 0.38
143 0.41
144 0.45
145 0.46
146 0.44
147 0.44
148 0.48
149 0.47
150 0.46
151 0.44
152 0.4
153 0.35
154 0.39
155 0.42
156 0.38
157 0.4