Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RX21

Protein Details
Accession A0A372RX21    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-71FQELKRRRKEFESKSNKKRRKTSGFIBasic
170-198EFDEVKKREEERKANKKKPKLYWGFETKHBasic
NLS Segment(s)
PositionSequence
48-66ELKRRRKEFESKSNKKRRK
175-189KKREEERKANKKKPK
Subcellular Location(s) nucl 22, mito_nucl 13.833, cyto_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR037690  FAM204A  
Amino Acid Sequences MDNSAVKIVRSSPRPKIFLNNKSSTEDKDNMKRQQPNIKSEKWERFQELKRRRKEFESKSNKKRRKTSGFITTQAEPSSTQQKHTKIKQKIKTFDITDPSTLPKSIANYLRMNEHLKGVDHGRLSTKTRLEKELDKAVENGDLELASKLSDQIAQNNYETMVNKAIERKEFDEVKKREEERKANKKKPKLYWGFETKHRWETKSNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.64
4 0.67
5 0.68
6 0.7
7 0.67
8 0.62
9 0.63
10 0.63
11 0.57
12 0.53
13 0.49
14 0.47
15 0.5
16 0.56
17 0.58
18 0.64
19 0.66
20 0.66
21 0.71
22 0.7
23 0.7
24 0.69
25 0.66
26 0.66
27 0.68
28 0.71
29 0.66
30 0.65
31 0.62
32 0.63
33 0.67
34 0.7
35 0.71
36 0.71
37 0.75
38 0.76
39 0.73
40 0.73
41 0.75
42 0.74
43 0.75
44 0.76
45 0.77
46 0.82
47 0.89
48 0.88
49 0.86
50 0.85
51 0.85
52 0.83
53 0.8
54 0.77
55 0.77
56 0.74
57 0.69
58 0.63
59 0.54
60 0.46
61 0.39
62 0.31
63 0.22
64 0.19
65 0.25
66 0.22
67 0.24
68 0.28
69 0.35
70 0.42
71 0.49
72 0.57
73 0.57
74 0.67
75 0.71
76 0.74
77 0.73
78 0.7
79 0.68
80 0.61
81 0.55
82 0.5
83 0.43
84 0.35
85 0.3
86 0.28
87 0.22
88 0.19
89 0.15
90 0.11
91 0.11
92 0.15
93 0.18
94 0.2
95 0.21
96 0.21
97 0.23
98 0.24
99 0.25
100 0.21
101 0.19
102 0.16
103 0.15
104 0.16
105 0.16
106 0.16
107 0.14
108 0.14
109 0.16
110 0.17
111 0.21
112 0.24
113 0.27
114 0.3
115 0.32
116 0.35
117 0.36
118 0.38
119 0.4
120 0.43
121 0.39
122 0.34
123 0.32
124 0.29
125 0.28
126 0.23
127 0.18
128 0.1
129 0.09
130 0.08
131 0.08
132 0.07
133 0.05
134 0.05
135 0.06
136 0.06
137 0.1
138 0.1
139 0.15
140 0.18
141 0.2
142 0.2
143 0.2
144 0.21
145 0.19
146 0.19
147 0.16
148 0.17
149 0.15
150 0.16
151 0.21
152 0.24
153 0.26
154 0.29
155 0.3
156 0.34
157 0.39
158 0.43
159 0.48
160 0.47
161 0.49
162 0.53
163 0.54
164 0.56
165 0.6
166 0.65
167 0.65
168 0.74
169 0.8
170 0.81
171 0.87
172 0.89
173 0.89
174 0.88
175 0.88
176 0.87
177 0.83
178 0.83
179 0.83
180 0.78
181 0.77
182 0.76
183 0.71
184 0.7
185 0.68
186 0.61