Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R938

Protein Details
Accession A0A372R938    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-50LTTNGASRRRGKKKERDEFIKBasic
NLS Segment(s)
PositionSequence
37-44RRRGKKKE
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MSIKQYPGRMERTQWCVVQPILANIKKIELTTNGASRRRGKKKERDEFIKYLTLSADGGNSTAQFNLGDAYTNGNYTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.39
4 0.36
5 0.33
6 0.26
7 0.24
8 0.28
9 0.28
10 0.28
11 0.24
12 0.26
13 0.23
14 0.22
15 0.19
16 0.13
17 0.16
18 0.18
19 0.23
20 0.26
21 0.28
22 0.32
23 0.38
24 0.46
25 0.5
26 0.56
27 0.6
28 0.66
29 0.74
30 0.81
31 0.81
32 0.79
33 0.77
34 0.72
35 0.66
36 0.6
37 0.49
38 0.4
39 0.32
40 0.25
41 0.18
42 0.15
43 0.12
44 0.07
45 0.08
46 0.07
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.13
58 0.13
59 0.15