Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QGK5

Protein Details
Accession A0A372QGK5   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-121AEFKQFKQFKPHKPKRSYKNHEQKKQNMVHydrophilic
NLS Segment(s)
PositionSequence
101-109FKPHKPKRS
Subcellular Location(s) nucl 21, cyto_nucl 15.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MLPPYFFIDGNKIHLIVAQRCIEVPSPVELSKQYYRCNGFIIYRGLLQDVLRGELLVDISRFASETWKIASKDFRNFFSDYARNTNGITAKRAEFKQFKQFKPHKPKRSYKNHEQKKQNMVSAIELEPFDFELEVFDIDREGFNNEREVFDFEQEVFDIEREGFNNEREVFDFEQEVFDIEREGFNNEREVFDFEQEVIDVEREGFNIEREVFMSEVFGRDVMEFEFISKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.26
4 0.3
5 0.27
6 0.26
7 0.26
8 0.29
9 0.27
10 0.23
11 0.21
12 0.19
13 0.2
14 0.2
15 0.21
16 0.2
17 0.25
18 0.32
19 0.34
20 0.34
21 0.38
22 0.42
23 0.41
24 0.43
25 0.39
26 0.33
27 0.34
28 0.34
29 0.28
30 0.25
31 0.24
32 0.22
33 0.21
34 0.18
35 0.17
36 0.13
37 0.14
38 0.12
39 0.11
40 0.11
41 0.1
42 0.11
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.08
49 0.07
50 0.1
51 0.1
52 0.11
53 0.13
54 0.19
55 0.2
56 0.22
57 0.3
58 0.31
59 0.39
60 0.41
61 0.41
62 0.39
63 0.39
64 0.38
65 0.37
66 0.35
67 0.29
68 0.32
69 0.31
70 0.28
71 0.27
72 0.29
73 0.26
74 0.23
75 0.23
76 0.19
77 0.2
78 0.24
79 0.25
80 0.29
81 0.29
82 0.32
83 0.4
84 0.46
85 0.46
86 0.53
87 0.6
88 0.64
89 0.7
90 0.77
91 0.76
92 0.78
93 0.85
94 0.84
95 0.88
96 0.86
97 0.85
98 0.86
99 0.86
100 0.85
101 0.84
102 0.81
103 0.79
104 0.73
105 0.64
106 0.55
107 0.46
108 0.38
109 0.32
110 0.25
111 0.17
112 0.14
113 0.12
114 0.1
115 0.09
116 0.08
117 0.05
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.07
129 0.08
130 0.09
131 0.13
132 0.13
133 0.14
134 0.15
135 0.18
136 0.17
137 0.17
138 0.17
139 0.13
140 0.13
141 0.13
142 0.12
143 0.08
144 0.08
145 0.07
146 0.07
147 0.08
148 0.08
149 0.1
150 0.11
151 0.11
152 0.16
153 0.16
154 0.16
155 0.17
156 0.2
157 0.18
158 0.18
159 0.18
160 0.13
161 0.13
162 0.13
163 0.12
164 0.08
165 0.08
166 0.07
167 0.07
168 0.08
169 0.08
170 0.1
171 0.11
172 0.11
173 0.16
174 0.16
175 0.16
176 0.17
177 0.2
178 0.18
179 0.18
180 0.18
181 0.14
182 0.13
183 0.13
184 0.12
185 0.09
186 0.09
187 0.08
188 0.08
189 0.09
190 0.08
191 0.1
192 0.1
193 0.1
194 0.14
195 0.14
196 0.13
197 0.14
198 0.16
199 0.14
200 0.13
201 0.15
202 0.12
203 0.13
204 0.13
205 0.12
206 0.11
207 0.11
208 0.12
209 0.1
210 0.12
211 0.1