Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q0D2

Protein Details
Accession A0A372Q0D2    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNQQHQHKPSIQRKRPWLIYEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR017884  SANT_dom  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
PS51293  SANT  
CDD cd00167  SANT  
Amino Acid Sequences MNQQHQHKPSIQRKRPWLIYEEMLLHELVNEYVNDWLLIASKLQTRTAHDCKIKYVELSKSNITQKNRFQNNVNNANNAIPPTTPVIVVPSNSRPINRNQKMDLRYIMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.74
4 0.68
5 0.61
6 0.55
7 0.49
8 0.42
9 0.33
10 0.27
11 0.23
12 0.18
13 0.14
14 0.12
15 0.09
16 0.08
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.05
24 0.06
25 0.06
26 0.06
27 0.07
28 0.1
29 0.11
30 0.14
31 0.15
32 0.18
33 0.26
34 0.3
35 0.36
36 0.36
37 0.36
38 0.35
39 0.38
40 0.34
41 0.27
42 0.26
43 0.25
44 0.25
45 0.27
46 0.26
47 0.27
48 0.33
49 0.37
50 0.38
51 0.39
52 0.43
53 0.5
54 0.54
55 0.52
56 0.5
57 0.53
58 0.58
59 0.62
60 0.56
61 0.47
62 0.43
63 0.42
64 0.38
65 0.3
66 0.22
67 0.11
68 0.12
69 0.13
70 0.13
71 0.12
72 0.11
73 0.14
74 0.15
75 0.16
76 0.19
77 0.2
78 0.26
79 0.27
80 0.29
81 0.28
82 0.37
83 0.47
84 0.51
85 0.53
86 0.53
87 0.6
88 0.61
89 0.64