Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RHN2

Protein Details
Accession A0A372RHN2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPSTPSQSRRRILRRLVKSRQVNRNTDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR028847  CENP-W  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0051382  P:kinetochore assembly  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF15510  CENP-W  
Amino Acid Sequences MPSTPSQSRRRILRRLVKSRQVNRNTDNLIYNHCKLFLQTLAQEANNEAETDNTNVVEEKHVKVALEFPGDSPIPWIQLQRKSGSGALRGFPHIMSCRVLPKEALPITIFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.84
5 0.86
6 0.86
7 0.86
8 0.84
9 0.8
10 0.73
11 0.71
12 0.64
13 0.56
14 0.51
15 0.41
16 0.4
17 0.38
18 0.36
19 0.29
20 0.27
21 0.24
22 0.21
23 0.22
24 0.17
25 0.14
26 0.13
27 0.15
28 0.16
29 0.16
30 0.16
31 0.14
32 0.13
33 0.11
34 0.11
35 0.08
36 0.07
37 0.08
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.07
44 0.09
45 0.1
46 0.1
47 0.11
48 0.12
49 0.12
50 0.12
51 0.14
52 0.14
53 0.14
54 0.13
55 0.12
56 0.15
57 0.15
58 0.14
59 0.14
60 0.12
61 0.13
62 0.13
63 0.17
64 0.19
65 0.26
66 0.29
67 0.29
68 0.3
69 0.3
70 0.33
71 0.32
72 0.32
73 0.28
74 0.28
75 0.27
76 0.28
77 0.26
78 0.23
79 0.24
80 0.22
81 0.21
82 0.21
83 0.21
84 0.27
85 0.28
86 0.3
87 0.26
88 0.25
89 0.33
90 0.31
91 0.32