Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q069

Protein Details
Accession A0A372Q069    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-84IPLTSNTKKKKVNKLKDKIRKLSPQIHydrophilic
NLS Segment(s)
PositionSequence
66-79KKKKVNKLKDKIRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKESELLINQQNSELRDKAKLWNMCYDRICQRVQLATRLTALQDLQGEKALIEQEILMIPLTSNTKKKKVNKLKDKIRKLSPQIEELLSALPSLKDILYYITEEERALEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.25
3 0.27
4 0.28
5 0.32
6 0.38
7 0.4
8 0.38
9 0.45
10 0.46
11 0.48
12 0.48
13 0.46
14 0.43
15 0.42
16 0.4
17 0.32
18 0.32
19 0.32
20 0.32
21 0.33
22 0.29
23 0.26
24 0.27
25 0.25
26 0.23
27 0.18
28 0.16
29 0.12
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.1
37 0.09
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.05
48 0.08
49 0.1
50 0.16
51 0.19
52 0.27
53 0.34
54 0.43
55 0.53
56 0.62
57 0.71
58 0.76
59 0.83
60 0.87
61 0.9
62 0.91
63 0.88
64 0.85
65 0.83
66 0.78
67 0.77
68 0.69
69 0.62
70 0.55
71 0.48
72 0.4
73 0.32
74 0.27
75 0.17
76 0.14
77 0.11
78 0.08
79 0.08
80 0.08
81 0.07
82 0.06
83 0.07
84 0.09
85 0.11
86 0.12
87 0.14
88 0.15
89 0.16
90 0.15